Tap / click on image to see more RealViewsTM
$39.55
per mug
 

Mug-Buck Coffee Mug

Qty:
Classic Mug
+$2.55
+$5.05

Other designs from this category

About Mugs

Sold by

Style: Classic Mug

Give a made-to-order mug from Zazzle to someone special, or treat yourself to a design that brings you joy or makes you laugh. Create your own photo mug, shop our collection of the funniest joke mugs, personalise your mug with a monogram, or express yourself with one of our 10 million designs.

  • Available in 325 ml or 443 ml
  • Dimensions:
    • 325 ml: 8.1 cm D x 9.7 cm H
    • 443 ml: 8.6 cm D x 11.4 cm H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Mug-Buck Coffee Mug

Mug-Buck Coffee Mug

Vintage image courtesy of Wikimedia Commons, public domain images...create on your choice of any mug. Composed in Photoshop

Customer Reviews

4.8 out of 5 stars rating22.2K Total Reviews
19640 total 5-star reviews1896 total 4-star reviews329 total 3-star reviews142 total 2-star reviews228 total 1-star reviews
22,235 Reviews
Reviews for similar products
5 out of 5 stars rating
By Leanne G.4 January 2021Verified Purchase
Classic Mug, 444 ml
Zazzle Reviewer Program
Very happy with the outcome of prints.. Just note just hoping they don’t wear off like my last mug. Thanku. The wording on the mug appears 10/10👍Thanku
5 out of 5 stars rating
By Sharon C.29 January 2021Verified Purchase
Classic Mug, 444 ml
Creator Review
The quality of these larger mugs is very good. I have been putting mine through the dishwasher all the time and it shows no signs of fading or dulling. Ergonomically these are lovely to hold and have fast become my favourite mug for a big cup of tea or coffee. Totally recommend getting the tea infuser with the mug especially if you like using loose leaf tea, which always tastes better from my experience and is better for the environment. Printing was good, bright and most importantly accurately matches the colouring shown on the website.
5 out of 5 stars rating
By A.3 December 2018Verified Purchase
Combo Mug, 325 ml
Zazzle Reviewer Program
Exactly as advertised. Amazed by the fast delivery, within a week and to my door, how easy is that ! Packaging secure and safe. Product as seen on website. Everything perfect. This first time customer will be back ! Purchased one for me and two as gifts. Product Perfect. Colour perfect too.

Tags

All Products
deerbuckswildlifeanimalsgiftsvintagemugs

Other Info

Product ID: 168029996757539293
Added on 27/9/12, 11:41 am
Rating: G