Tap / click on image to see more RealViewsTM
$31.50
each
 

Mr & Mrs Script Glass Coaster

Qty:

    Other designs from this category

    About Coasters

    Sold by

    Style: Glass Coaster

    Top your tables with beautiful glass coasters perfect for your cold or hot drinks. Made with 100% glass, these coasters can also serve as a trivet for your smaller pots and pans to keep your counter free from scratches. Customise a classy glass coaster to match your decor!

    • Dimensions: 10.7 cm l x 10.7 cm w x 1 cm h
    • Smooth glass top, finished with 3M™ Bumpon™ rubber feet
    • Designs printed in vibrant full colour
    • Dishwasher safe
    Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 10.4 cm x 10.4 cm. For best results please add a 3 mm bleed

    About This Design

     Mr & Mrs Script Glass Coaster

    Mr & Mrs Script Glass Coaster

    Celebrate love in elegant style with this timeless "Mr. & Mrs." script design. Featuring modern calligraphy with a romantic touch. Perfect for yourself or as a gift. Whether you're personalising for yourself or as a gift, this classic motif adds a sophisticated and heartfelt touch to any occasion.

    Customer Reviews

    4.6 out of 5 stars rating37 Total Reviews
    32 total 5-star reviews2 total 4-star reviews0 total 3-star reviews1 total 2-star reviews2 total 1-star reviews
    37 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Janeanne W.23 July 2025Verified Purchase
    Glass Coaster
    So perfect- gifting for a group of friends that get together every year!! Thru will love it!!
    from zazzle.com (US)
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Kelly-Ann R.24 August 2026Verified Purchase
    Glass Coaster
    These were beautiful. I used them at the rehearsal dinner for the head table. The bride and groom loved them.
    from zazzle.com (US)
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Kimberly J.1 January 2026Verified Purchase
    Glass Coaster
    Everything was good. Delivered on time. The products were beautiful. Everyone who saw the products said good job using zazzle.com.
    from zazzle.com (US)

    Tags

    Coasters
    mr and mrsgiftkeepsakenewlywedsscriptjust marriedelegantcouples giftweddinganniversary
    All Products
    mr and mrsgiftkeepsakenewlywedsscriptjust marriedelegantcouples giftweddinganniversary

    Other Info

    Product ID: 256805884841855382
    Added on 7/8/25, 5:20 am
    Rating: G