Tap / click on image to see more RealViewsTM
$31.50
each
 

Mr & Mrs Script Glass Coaster

Qty:

Other designs from this category

About Coasters

Sold by

Style: Glass Coaster

Top your tables with beautiful glass coasters perfect for your cold or hot drinks. Made with 100% glass, these coasters can also serve as a trivet for your smaller pots and pans to keep your counter free from scratches. Customise a classy glass coaster to match your decor!

  • Dimensions: 10.7 cm l x 10.7 cm w x 1 cm h
  • Smooth glass top, finished with 3M™ Bumpon™ rubber feet
  • Designs printed in vibrant full colour
  • Dishwasher safe
Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 10.4 cm x 10.4 cm. For best results please add a 3 mm bleed

About This Design

 Mr & Mrs Script Glass Coaster

Mr & Mrs Script Glass Coaster

Celebrate love in elegant style with this timeless "Mr. & Mrs." script design. Featuring modern calligraphy with a romantic touch. Perfect for yourself or as a gift. Whether you're personalising for yourself or as a gift, this classic motif adds a sophisticated and heartfelt touch to any occasion.

Customer Reviews

4.6 out of 5 stars rating36 Total Reviews
31 total 5-star reviews2 total 4-star reviews0 total 3-star reviews1 total 2-star reviews2 total 1-star reviews
36 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Janeanne W.23 July 2025Verified Purchase
Glass Coaster
So perfect- gifting for a group of friends that get together every year!! Thru will love it!!
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kimberly J.1 January 2026Verified Purchase
Glass Coaster
Everything was good. Delivered on time. The products were beautiful. Everyone who saw the products said good job using zazzle.com.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By JEFF P.17 September 2024Verified Purchase
Glass Coaster
OMG these glass coasters are so cute and classy and PERFECT. I’m so glad I found your site and I love the coasters! Thank you!
from zazzle.com (US)

Tags

Coasters
mr and mrsgiftkeepsakenewlywedsscriptjust marriedelegantcouples giftweddinganniversary
All Products
mr and mrsgiftkeepsakenewlywedsscriptjust marriedelegantcouples giftweddinganniversary

Other Info

Product ID: 256805884841855382
Added on 7/8/25, 5:20 am
Rating: G