Tap / click on image to see more RealViewsTM
$92.80
per cushion
 

Mr & Mrs photo Cushion

Qty:
40 cm Throw Pillow
+$23.05
+$48.05

Other designs from this category

About Cushions

Sold by

Size: 40 cm Throw Pillow

Accent your home with custom cushions from Zazzle and make yourself the envy of the neighbourhood. Made from high-quality Simplex knit fabric, these 100% polyester cushions are soft and wrinkle-free. The heavyweight stretch material provides beautiful colour definition for your design while also being the perfect complement to your sofa!

  • Dimensions: 40.6 cm x 40.6 cm (square)
  • Simplex knit fabric; 100% polyester; wrinkle-free
  • Hidden zip enclosure; synthetic-filled insert included
  • Machine washable
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 40.6 cm. For best results, please add 1.5 cm bleed.

About This Design

 Mr & Mrs photo Cushion

Mr & Mrs photo Cushion

Celebrate love in elegant style with this timeless "Mr. & Mrs." script design. Featuring modern calligraphy with a romantic touch. Perfect for yourself or as a gift. Whether you're personalising for yourself or as a gift, this classic motif adds a sophisticated and heartfelt touch to any occasion.

Customer Reviews

4.7 out of 5 stars rating233 Total Reviews
191 total 5-star reviews32 total 4-star reviews5 total 3-star reviews3 total 2-star reviews2 total 1-star reviews
233 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Gaylene A.12 June 2017Verified Purchase
Throw Pillow, 40 cm Throw Pillow
Zazzle Reviewer Program
I absolutely love this product. I turned out even better than I expected too. I bought this for my mother for Mother's Day and she really loves it, she shows it too everyone she can and they all love it as well and want to know where I bought it from. The design turned out perfect, the printing of the words is fantastic they were so clear and easy to read, the color was also nicer than I thought it would be plus the images are so clear to see. I myself can't seem to keep looking at it, it's just gorgeous I love it, it couldn't have turned out any better
5.0 out of 5 stars rating
5 out of 5 stars rating
By Denise8 February 2020Verified Purchase
Throw Pillow, 40 cm Throw Pillow
Zazzle Reviewer Program
Loved the pillow very happy with the end result thanks. Clear so so happy thankyou
5.0 out of 5 stars rating
5 out of 5 stars rating
By Dianne C.22 November 2018Verified Purchase
Throw Pillow, 40 cm Throw Pillow
Zazzle Reviewer Program
Loved how the product came out, colours etc. Really good, colours perfect, photos clear etc.

Tags

Cushions
mr and mrsgiftkeepsakenewlywedsscriptjust marriedelegantcouples giftweddinganniversary
All Products
mr and mrsgiftkeepsakenewlywedsscriptjust marriedelegantcouples giftweddinganniversary

Other Info

Product ID: 256765352674582625
Added on 7/8/25, 5:15 am
Rating: G