Tap / click on image to see more RealViewsTM
$80.45
per wallpaper
 

Mountain Village Nursery Wallpaper

by
Qty:

Other designs from this category

About Wallpapers

Sold by

Style: Textured vinyl

Introducing our Peel and Stick Wallpaper, a game-changer for effortless room transformations. This high-quality wallpaper features a matte finish embossed with a canvas texture and a hassle-free peel-and-stick application, making it a breeze to revamp your living spaces. Choose from textured vinyl or smooth vinyl and six different sizes, including a swatch so you can test the application, and find that perfect fit, ranging from small accent walls to large room makeovers.

  • Easy Maintenance: The wallpaper's surface allows for easy cleaning and maintenance, making it perfect for busy households or high-traffic areas.
  • Residue-free Removal: When it's time for a change, our wallpaper can be easily removed without leaving any residue or damaging your walls, allowing for a hassle-free transition.
  • Versatile Design Options: Choose from a wide range of captivating designs, patterns, and colours to suit your personal style and enhance the ambiance of any room.
  • DIY-Friendly: Our Peel and Stick Wallpaper is designed for easy DIY installation, making it accessible to anyone. No professional skills or tools are required, saving you time and money.

About This Design

Mountain Village Nursery Wallpaper

Mountain Village Nursery Wallpaper

Create a cosy, storybook atmosphere in your little one’s room with this minimalist mountain village wallpaper. Featuring soft neutral-toned mountains, evergreen trees, and tiny cabins on a creamy backdrop, this charming design brings warmth and calm to your nursery. Perfect for gender-neutral, woodland, or adventure-themed rooms, the soft watercolor aesthetic adds a gentle, nature-inspired touch to any baby or toddler space.

Customer Reviews

There are no reviews for this product yet.Have you purchased this product?

Tags

Wallpapers
mountainnurserywallpapervillagewallpaperforkidsminimalistnurserydecorgenderneutralnurserywoodlandnurserysnowymountainwallpaperbabyroomdecoradventurethemednurserycabinandtreewallpaperwatercolorbabyroom
All Products
mountainnurserywallpapervillagewallpaperforkidsminimalistnurserydecorgenderneutralnurserywoodlandnurserysnowymountainwallpaperbabyroomdecoradventurethemednurserycabinandtreewallpaperwatercolorbabyroom

Other Info

Product ID: 256110227772848490
Added on 20/4/25, 4:42 am
Rating: G