Tap / click on image to see more RealViewsTM
$153.00
per wallpaper
 

Modern Green Leaf Pattern Wallpaper

Qty:

About Wallpapers

Sold by

Style: Smooth Vinyl

Introducing our Peel and Stick Wallpaper, a game-changer for effortless room transformations. This high-quality wallpaper features a matte finish and a hassle-free peel-and-stick application, making it a breeze to revamp your living spaces. Choose from textured vinyl or smooth vinyl and six different sizes, including a swatch so you can test the application, and find that perfect fit, ranging from small accent walls to large room makeovers.

  • Easy Maintenance: The wallpaper's smooth surface allows for easy cleaning and maintenance, making it perfect for busy households or high-traffic areas.
  • Residue-free Removal: When it's time for a change, our wallpaper can be easily removed without leaving any residue or damaging your walls, allowing for a hassle-free transition.
  • Versatile Design Options: Choose from a wide range of captivating designs, patterns, and colors to suit your personal style and enhance the ambiance of any room.
  • DIY-Friendly: Our Peel and Stick Wallpaper is designed for easy DIY installation, making it accessible to anyone. No professional skills or tools are required, saving you time and money.

About This Design

Modern Green Leaf Pattern  Wallpaper

Modern Green Leaf Pattern Wallpaper

Modern green leaf pattern on a white background. Soft chalky textured look of leaves in green with a hint of powdery white seeping through.

Customer Reviews

4.1 out of 5 stars rating9 Total Reviews
6 total 5-star reviews0 total 4-star reviews2 total 3-star reviews0 total 2-star reviews1 total 1-star reviews
9 Reviews
Reviews for similar products
5 out of 5 stars rating
By Awake A.12 April 2025Verified Purchase
Custom Wallpaper 0.61m x 1.22m, Textured vinyl
This is my second terrific, custom-designed Zazzle purchase. My custom-designed wallpaper is fabulous!! It arrived super well-packaged, and on time. It is really beautiful and of very high quality. I think this designer is extremely talented. She certainly knows how to follow instructions for a perfect custom design! You would do well to buy anything from Zazzle and, in particular, this designer. Excellent experience!!
from zazzle.com (US)
5 out of 5 stars rating
By Charles K.15 August 2025Verified Purchase
Custom Wallpaper 0.61m x 1.22m, Textured vinyl
It is fabulous! Am always excited to show others. It is dramatic!!
from zazzle.com (US)
5 out of 5 stars rating
By Suzanne R.18 September 2025Verified Purchase
Custom Wallpaper 0.61m x 1.22m, Textured vinyl
Great xxxxxxxccc. Yuyyyyyyyyyyyyyyyyyy.
from zazzle.com (US)

Tags

Wallpapers
greenleafplantpatternchalkwhitemodernbeautifulsummerelegant
All Products
greenleafplantpatternchalkwhitemodernbeautifulsummerelegant

Other Info

Product ID: 256612140829457102
Added on 16/8/24, 3:35 pm
Rating: G