Tap / click on image to see more RealViewsTM
$210.00
per wallpaper
 

Minimalist Green Botanical Nursery Wallpaper

by
Qty:

Other designs from this category

About Wallpapers

Sold by

Style: Textured vinyl

Introducing our Peel and Stick Wallpaper, a game-changer for effortless room transformations. This high-quality wallpaper features a matte finish embossed with a canvas texture and a hassle-free peel-and-stick application, making it a breeze to revamp your living spaces. Choose from textured vinyl or smooth vinyl and six different sizes, including a swatch so you can test the application, and find that perfect fit, ranging from small accent walls to large room makeovers.

  • Easy Maintenance: The wallpaper's surface allows for easy cleaning and maintenance, making it perfect for busy households or high-traffic areas.
  • Residue-free Removal: When it's time for a change, our wallpaper can be easily removed without leaving any residue or damaging your walls, allowing for a hassle-free transition.
  • Versatile Design Options: Choose from a wide range of captivating designs, patterns, and colours to suit your personal style and enhance the ambiance of any room.
  • DIY-Friendly: Our Peel and Stick Wallpaper is designed for easy DIY installation, making it accessible to anyone. No professional skills or tools are required, saving you time and money.

About This Design

Minimalist Green Botanical Nursery Wallpaper

Minimalist Green Botanical Nursery Wallpaper

Bring the calming essence of nature into your baby’s nursery with this elegant minimalist wallpaper featuring hand-drawn botanical leaves in soft green tones. Set against a warm cream background, this design blends effortlessly into modern, boho, or nature-inspired interiors. Perfect for gender-neutral nurseries, toddler rooms, or play spaces, the subtle leafy pattern adds a serene and refreshing touch to any room. A timeless look that grows with your child.

Customer Reviews

There are no reviews for this product yet.Have you purchased this product?

Tags

Wallpapers
botanicalnurserywallpapergreenleafwallpaperminimalistnurserydecorgenderneutralnurseryleafywallartbohonurserydesignnatureinspirednurseryplantthemenurserycalmingnurseryvibesmodernnurserylook
All Products
botanicalnurserywallpapergreenleafwallpaperminimalistnurserydecorgenderneutralnurseryleafywallartbohonurserydesignnatureinspirednurseryplantthemenurserycalmingnurseryvibesmodernnurserylook

Other Info

Product ID: 256198764556928191
Added on 20/4/25, 3:37 am
Rating: G