Tap / click on image to see more RealViewsTM
$11.45
per sticker
 

Meerkat

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Small 7.62 cm x 7.62 cm Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 7.6 cm L x 3.12.7 cm W
  • Design Area: 7.6 cm L x 7.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Meerkat

Meerkat

A meerkat sticker typically features this small, curious mammal with its distinctive upright posture, large dark eyes, and pointed ears. The design may show the meerkat standing on its hind legs, scanning the surroundings for danger, or interacting with its group in a playful or alert manner. Known for their social structure and constant vigilance, meerkats are often depicted in groups, reflecting their cooperative and energetic nature. Whether realistic or stylised, the sticker captures the meerkat's endearing and inquisitive personality, making it perfect for animal lovers, wildlife enthusiasts, or anyone who enjoys the charm of this iconic desert dweller.

Customer Reviews

4.5 out of 5 stars rating1.2K Total Reviews
938 total 5-star reviews67 total 4-star reviews28 total 3-star reviews30 total 2-star reviews91 total 1-star reviews
1,154 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By C.1 March 2021Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I'm super happy with this beautiful Owl Mandala transfer. It suits my car perfectly. If I could have bought a bigger one, I would've! High-quality printing and materials. I believe the transfer will be relatively weather-resistant. Only time will tell.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Blake C.12 October 2020Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
To be honest, I wasn't expecting much, as I am using these stickers as a decal for my ute doors. That being said, it is extremely affordable, and to get these done on another website I saw, they wanted to charge me over $100 for smaller. These stickers are amazing quality and well worth the money. By far exceeded my expectations and will do the job nicely. The stick great. The only thing I would change is instead of a cut out of each part, if they'd have the backing, sticker, then clear over the top for easy application because the moment I tore off the front to apply the sticker, the lettering stayed on the backing paper causing me to have to use the front as a boarder/stencil and carefully apply the lettering inside the lines. But either way, I'm very happy. Thank you. The printing was awesome. Top quality and no issues whatsoever. As I stated in the "what I thought about this product" section, The only thing I would change is instead of a cut out of each part, if they'd have the backing paper, sticker, then clear over the top that the front of the sticker sticks to for easy application in one go. Because the moment I tore off the front to apply the sticker, the lettering stayed on the backing paper causing me to have to use the front as a boarder/stencil and carefully apply the lettering inside the lines
4.0 out of 5 stars rating
4 out of 5 stars rating
By Galit B.28 December 2023Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
The stick looks amazing. Unfortunately, it would not stick on our suitcase as it was textured. When we found a non-textured (smooth) suitcase, the sticker stuck and looks great. The printing looked awesome.

Tags

Custom-Cut Vinyl Stickers
meerkatstickermeerkatstickersmeerkatstickersetsymeerkatwallstickersmeerkatdecalstickersismeerkatlegalinmalaysiameerkatmoviesmeerkatnamesnameofmeerkatsinmeerkatadvertmeerkatdescriptionmeerkatstatus
All Products
meerkatstickermeerkatstickersmeerkatstickersetsymeerkatwallstickersmeerkatdecalstickersismeerkatlegalinmalaysiameerkatmoviesmeerkatnamesnameofmeerkatsinmeerkatadvertmeerkatdescriptionmeerkatstatus

Other Info

Product ID: 256427463681303060
Added on 11/11/24, 8:49 pm
Rating: G