Tap / click on image to see more RealViewsTM
$81.55
per poster
 

Medieval Chainmail Patent Blueprint Poster

Qty:
60.96 cm x 81.28 cm
None

Other designs from this category

About Posters

Sold by

Paper Type: Standard Semi-Gloss

Your walls are a reflection of your personality, so let them speak with your favourite quotes, art, or designs printed on our custom Giclée posters! High-quality, microporous resin-coated paper with a beautiful semi-gloss finish. Choose from standard or custom-sized posters and framing options to create art that’s a perfect representation of you.

  • Gallery-quality Giclée prints
  • Ideal for vibrant artwork and photographic reproduction
  • Semi-gloss finish
  • Pigment-based inks for full-colour spectrum high-resolution printing
  • Durable 185gsm paper
  • Available in custom sizing up to 152.4 cm
  • Frames available on all standard sizes
  • Frames include Non-Glare Acrylic Glazing

About This Design

Medieval Chainmail Patent Blueprint Poster

Medieval Chainmail Patent Blueprint Poster

Vintage patent-style illustration of chainmail armour with knight figure and construction diagrams, emphasising rivets, texture, and medieval craftsmanship for a unique apparel motif.

Customer Reviews

4.8 out of 5 stars rating14.7K Total Reviews
12617 total 5-star reviews1371 total 4-star reviews274 total 3-star reviews161 total 2-star reviews320 total 1-star reviews
14,743 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jubelen P.27 February 2020Verified Purchase
Print, Size: 76.20cm x 50.80cm, Media: Standard Semi-Gloss
Zazzle Reviewer Program
my staff loves it , and other branch is asking me where i got this and i give your website to them. maybe you can add up on personalised option, laminated or a frame maybe . great job. but you can add an option if we wanted to have it laminated or frame as add up option
5.0 out of 5 stars rating
5 out of 5 stars rating
By Timothy G.14 October 2021Verified Purchase
Zazzle Reviewer Program
I hung this in the stairwell of our house, near some other Renoir pictures. My daughter says it looks like she is looking at her when she walks up the stairs. it's called "The Excursionist", she is holding a walking stick. Renoir was an impressionist, I don't think this is an actual person. The finished framed picture arrived and looks better than the online pic - Beautiful!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ross Y.31 December 2019Verified Purchase
Print, Size: 48.26cm x 33.02cm, Media: Standard Semi-Gloss
Zazzle Reviewer Program
Absolutely superb Art Deco poster. The colours are vibrant, sympathetic to the era and perfect for use. I framed it and hung above the entrance to my Art Deco inspired lounge room. Stunning! The print is precise, clear and of an excellent standard. It was cleverly packaged so there wasn’t a blemish or crease. Perfect!

Tags

Posters
armourknightmedievalcraftsmanshipmedieval armorarmormedieval lovermedieval giftchainmailmedieval design
All Products
armourknightmedievalcraftsmanshipmedieval armorarmormedieval lovermedieval giftchainmailmedieval design

Other Info

Product ID: 256234444112308138
Added on 8/1/26, 9:59 pm
Rating: G