Tap / click on image to see more RealViewsTM
$126.95
per cushion
 

Medieval Chainmail Patent Blueprint Cushion

Qty:
50 cm Throw Pillow
-$22.65
-$43.05

About Cushions

Sold by

Size: 50 cm Throw Pillow

Accent your home with custom cushions from Zazzle and make yourself the envy of the neighbourhood. Made from high-quality Simplex knit fabric, these 100% polyester cushions are soft and wrinkle-free. The heavyweight stretch material provides beautiful colour definition for your design while also being the perfect complement to your sofa!

  • Dimensions: 50.8 cm x 50.8 cm (square)
  • Simplex knit fabric; 100% polyester; wrinkle-free
  • Hidden zip enclosure; synthetic-filled insert included
  • Machine washable
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 50.8 cm x 50.8 cm. For best results, please add 1.5 cm bleed.

About This Design

Medieval Chainmail Patent Blueprint Cushion

Medieval Chainmail Patent Blueprint Cushion

Vintage patent-style illustration of chainmail armour with knight figure and construction diagrams, emphasising rivets, texture, and medieval craftsmanship for a unique apparel motif.

Customer Reviews

4.8 out of 5 stars rating9.6K Total Reviews
8350 total 5-star reviews906 total 4-star reviews196 total 3-star reviews77 total 2-star reviews117 total 1-star reviews
9,646 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By S.23 August 2020Verified Purchase
Throw Pillow, 40 cm Throw Pillow
Zazzle Reviewer Program
Loved it - truly unique & it will be the only one in the world. Very happy with product & fast delivery from USA to Australia. Looks awesome - bright and clear print. Very happy with the product.
5.0 out of 5 stars rating
5 out of 5 stars rating
By G.16 December 2020Verified Purchase
Throw Pillow, 40 cm Throw Pillow
Zazzle Reviewer Program
Loved how this turned out. I used a photo from one of my paintings, gifted it to my daughter, she adored it. Very crisp and clear. Turned out better than I thought it would. Perfect!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Carol F.14 November 2021Verified Purchase
Throw Pillow, 40 cm Throw Pillow
Zazzle Reviewer Program
i have to give 5 stars for this pillow . it helps us get thru the days without our baby .the wording was excellent . great printing . well read

Tags

Cushions
armourknightmedievalcraftsmanshipmedieval armorarmormedieval lovermedieval giftchainmailmedieval design
All Products
armourknightmedievalcraftsmanshipmedieval armorarmormedieval lovermedieval giftchainmailmedieval design

Other Info

Product ID: 256043280057031508
Added on 8/1/26, 9:58 pm
Rating: G