Tap / click on image to see more RealViewsTM
$4.90
per sticker
 

Mars Science Laboratory Curiosity Rover. 4

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Small 7.62 cm x 7.62 cm Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 7.6 cm L x 3.12.7 cm W
  • Design Area: 7.6 cm L x 7.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Mars Science Laboratory Curiosity Rover. 4

Mars Science Laboratory Curiosity Rover. 4

Artist's concept of Mars Science Laboratory Curiosity rover, a mobile robot for investigating Mars' past or present ability to sustain microbial life. In this picture, the rover examines a rock on Mars with a set of tools at the end of the rover's arm, which extends about 7 feet. Two instruments on the arm can study rocks up close. A drill can collect sample material from inside of rocks and a scoop can pick up samples of soil. The arm can sieve the samples and deliver fine powder to instruments inside the rover for thorough analysis. The mast rises to about 6.9 feet above ground level. This mast supports two remote-sensing science instruments: the Mast Camera, for stereo colour viewing of surrounding terrain and material collected by the arm; and, the Chemistry and Camera instrument, which uses a laser to vaporise a speck of material on rocks up to about 23 feet away and determines what elements the rocks are made of.

Customer Reviews

4.5 out of 5 stars rating1.2K Total Reviews
936 total 5-star reviews67 total 4-star reviews28 total 3-star reviews28 total 2-star reviews91 total 1-star reviews
1,150 Reviews
Reviews for similar products
5 out of 5 stars rating
By C.1 March 2021Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I'm super happy with this beautiful Owl Mandala transfer. It suits my car perfectly. If I could have bought a bigger one, I would've! High-quality printing and materials. I believe the transfer will be relatively weather-resistant. Only time will tell.
5 out of 5 stars rating
By Blake C.12 October 2020Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
To be honest, I wasn't expecting much, as I am using these stickers as a decal for my ute doors. That being said, it is extremely affordable, and to get these done on another website I saw, they wanted to charge me over $100 for smaller. These stickers are amazing quality and well worth the money. By far exceeded my expectations and will do the job nicely. The stick great. The only thing I would change is instead of a cut out of each part, if they'd have the backing, sticker, then clear over the top for easy application because the moment I tore off the front to apply the sticker, the lettering stayed on the backing paper causing me to have to use the front as a boarder/stencil and carefully apply the lettering inside the lines. But either way, I'm very happy. Thank you. The printing was awesome. Top quality and no issues whatsoever. As I stated in the "what I thought about this product" section, The only thing I would change is instead of a cut out of each part, if they'd have the backing paper, sticker, then clear over the top that the front of the sticker sticks to for easy application in one go. Because the moment I tore off the front to apply the sticker, the lettering stayed on the backing paper causing me to have to use the front as a boarder/stencil and carefully apply the lettering inside the lines
4 out of 5 stars rating
By Galit B.28 December 2023Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
The stick looks amazing. Unfortunately, it would not stick on our suitcase as it was textured. When we found a non-textured (smooth) suitcase, the sticker stuck and looks great. The printing looked awesome.

Tags

Custom-Cut Vinyl Stickers
spacerobotic spacecraftvehiclewheelsampleadventureplanetary sciencefuturisticall terrain vehiclesmobility
All Products
spacerobotic spacecraftvehiclewheelsampleadventureplanetary sciencefuturisticall terrain vehiclesmobility

Other Info

Product ID: 256649989761917520
Added on 19/1/24, 10:53 am
Rating: G 
Copyright © 2024 StockTrek Images