Tap / click on image to see more RealViewsTM
$60.50
per tie
 

Luxury Baroque Floral Tie

4.5 out of 5 stars rating
2519 Total Reviews |
by
Qty:

Other designs from this category

About Ties

Sold by
Neck TieCreate your own from scratch

Style: Tie

Upgrade your wardrobe with a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139 cm
    • Width: 10.1 cm (at widest point)
  • Printed in vibrant full colour
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customise
  • Dry clean only

About This Design

Luxury Baroque Floral Tie

Luxury Baroque Floral Tie

Make a sophisticated statement with this luxury Baroque floral tie featuring elegant botanical artwork on a rich emerald green background. Inspired by classic European floral patterns, ornate scrolling vines, and timeless Victorian elegance, this original design blends vintage charm with modern refinement. Perfect for weddings, formal events, business attire, holiday celebrations, and upscale occasions, this premium necktie pairs beautifully with navy, charcoal, black, and deep green suits. The luxurious floral motif creates an elegant accessory for grooms, wedding guests, professionals, and anyone who appreciates classic style. Designed exclusively by StudioHarbor, this original floral necktie brings timeless European-inspired elegance to every wardrobe.
StudioHarbor
Artwork designed by
Ganemulla, western province, Sri Lanka
View their Store

Customer Reviews

4.5 out of 5 stars rating2.5K Total Reviews
1846 total 5-star reviews331 total 4-star reviews142 total 3-star reviews75 total 2-star reviews125 total 1-star reviews
2,519 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous6 April 2025 • Verified Purchase
Tie
Lovely. My English class was impressed!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Amy C.17 May 2022 • Verified Purchase
Tie
Zazzle Reviewer Program
It's absolutely perfect!! Turned out much better then I expected ❤️ It is a little expensive but very worth it. Printing is perfect can read it very well
5.0 out of 5 stars rating
5 out of 5 stars rating
By Geoff T.25 January 2021 • Verified Purchase
Tie
Zazzle Reviewer Program
Great company, gave me a generous credit when I made an ordering mistake. Delivery of products very quick. Highly recommended. Quality of the product is excellent

Tags

Ties
baroquetiefloraltiebotanicaltievictoriantieluxurynecktieweddingtiemenstieemeraldtieformaltiegiftforhim
All Products
baroquetiefloraltiebotanicaltievictoriantieluxurynecktieweddingtiemenstieemeraldtieformaltiegiftforhim

Other Info

Product ID: 256867087941461916
Added on 17/7/26, 11:12 pm
Rating: G