Tap / click on image to see more RealViewsTM
The velvet details are simulated in the artwork. No actual velvet will be used in the making of this product.
$40.95
per roll
 

Luxury 24K Poinsettia Ruby & Gold Christmas Wrapping Paper

Qty:

Other designs from this category

Shop this collection

Bryan Spencer
Merry & Bright Christmas CollectionDesigned by Bryan Spencer
Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Wrapping Paper

Sold by

Paper Finish: Matte Wrapping Paper

Make sure every gift you give has a layer of love by creating custom wrapping paper. Available in four types of premium paper and five different sizes, our wrapping paper covers all your gift wrapping needs - because presentation matters as much as the gift!

  • 64lb print quality matte paper
  • Ideal for printing photos
  • Full colour edge-to-edge printing
  • Width: 74 cm
  • Length: multiple options from 1.8 m to 18.3 m
  • Each roll up to 4.6 m in length; lengths greater than 4.6 m shipped as multiple 4.6 m rolls
  • Length guide:
    • 1.8 m roll wraps 3 shirt-sized boxes
    • 4.6 m roll wraps 9 shirt-sized boxes
    • 9.1 m roll wraps 18 shirt-sized boxes
    • 13.7 m roll wraps 27 shirt-sized boxes
    • 18.3 m roll wraps 36 shirt-sized boxes
  • Designable area is 91 x 76 cm, but scaled down uniformly and printed at 88.4 x 73.7 cm
  • Please note: Designs are tiled after first 88.4 x 73.7 cm printed section

About This Design

The velvet details are simulated in the artwork. No actual velvet will be used in the making of this product.
Luxury 24K Poinsettia Ruby & Gold Christmas Wrapping Paper

Luxury 24K Poinsettia Ruby & Gold Christmas Wrapping Paper

Turn every gift into a masterpiece with our Ruby & Gold Christmas Wrapping Paper – Luxury 24K Poinsettia Holiday Gift Wrap. This opulent design features a deep ruby velvet background enriched with 24K metallic gold poinsettias, pinecones, holly leaves, and swirling flourishes that glisten with festive radiance. The diagonal repeating pattern creates a harmonious rhythm that feels both timeless and regal — perfect for luxury gift presentations, boutique branding, and high-end holiday packaging. Every inch of this 4K design balances romantic warmth and luminous contrast, bringing a touch of grandeur to your celebrations. Ideal for those who adore rich, classic Christmas tones with a modern elegant twist. ✨ Features: 4K ultra-detailed, seamless repeating pattern Deep ruby red base with radiant 24K gold accents Opulent poinsettia and holly motif for a classic yet sophisticated look Perfect for premium gifts, boutique packaging, or luxury holiday décor Available in matte, satin, and glossy finishes Wrap your holiday moments in ruby and gold — where tradition meets timeless luxury.

Customer Reviews

4.7 out of 5 stars rating4K Total Reviews
3373 total 5-star reviews381 total 4-star reviews111 total 3-star reviews69 total 2-star reviews83 total 1-star reviews
4,017 Reviews
Reviews for similar products
5 out of 5 stars rating
By Trish C.20 November 2020Verified Purchase
Wrapping Paper, Matte Wrapping Paper
Zazzle Reviewer Program
I needed a vintage looking paper to line some draws of some furniture I upcycled and this gingham paper fit the bill perfectly. The paper was very easy to use and it turned out beautifully. The colour and quality was excellent.
5 out of 5 stars rating
By Siobhan S.31 October 2019Verified Purchase
Wrapping Paper, Glossy Wrapping Paper
Zazzle Reviewer Program
The colours are amazing I will definitely be buying this one again. Excellent.............................................
5 out of 5 stars rating
By Siobhan S.26 October 2019Verified Purchase
Wrapping Paper, Glossy Wrapping Paper
Zazzle Reviewer Program
Looks fantastic on furniture. Excellent....................................

Tags

Wrapping Paper
All Products
rubygoldbellsbowsholidayschristmasgiftwrappingpaperluxury

Other Info

Product ID: 256950554251186583
Added on 15/10/25, 8:42 am
Rating: G