Tap / click on image to see more RealViewsTM
Sale Price $3.97.  
Original Price $5.29 per card
You save 25%

Loving Words Valentine's Day Greeting Card

Qty:
Choose Your Format
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.30

Other designs from this category

About Folded Holiday Cards

Sold by

Size: Standard, 12.7 cm x 17.8 cm

Wishing everyone a season of gladness, a season of cheer and to top it all off, a wonderful year. Holiday cards designed to brighten up the entire year.

  • Dimensions: 12.7 cm x 17.8 cm (portrait); 17.8 cm x 12.7 cm (landscape)
  • Full colour CMYK print process
  • Double sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Loving Words Valentine's Day Greeting Card

Loving Words Valentine's Day Greeting Card

a unique approach to valentine's day cards...© 2004-2014 MarloDee Designs :: All rights reserved. All necessary licenses have been purchased and are on file. Images on this site are NOT public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing.

Customer Reviews

4.9 out of 5 stars rating6.9K Total Reviews
6401 total 5-star reviews342 total 4-star reviews63 total 3-star reviews32 total 2-star reviews60 total 1-star reviews
6,898 Reviews
Reviews for similar products
5 out of 5 stars rating
By D.10 February 2020Verified Purchase
Folded Holiday Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte
Zazzle Reviewer Program
Happy with this card maybe you could make the hearts stand out more. Yes the printing was fine thanks
5 out of 5 stars rating
By Kari Y.10 February 2021Verified Purchase
Folded Holiday Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte
Zazzle Reviewer Program
I ordered this card for my husband for valentine's day and it turned out beautifully! The color is clear and soft the way I wanted it and the pictures i uploaded look wonderful! 10/10 will use again and would recommend to anyone. Beautiful soft colors. Clear, gorgeous pictures and text. Not only did my card arrive on time it arrived a day early and I ordered only 6 days before Valentines day!
from zazzle.com (US)
4 out of 5 stars rating
By D.10 February 2020Verified Purchase
Folded Holiday Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte
Zazzle Reviewer Program
It’s fine not what I expected not very fancy o well thanks. Not that great I guess it is very plain thanks anyway

Tags

Folded Holiday Cards
valentinesdaylovesweetestweddingpinkchicstylishunique
All Products
valentinesdaylovesweetestweddingpinkchicstylishunique

Other Info

Product ID: 137642364302511547
Added on 19/1/14, 3:27 pm
Rating: G