Tap / click on image to see more RealViewsTM
$45.50
per shirt
 

Keep Calm Plants Have Protein T-Shirt

Qty:
Basic Dark T-Shirt
-$2.15
+$15.10
Black
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Basic Dark T-Shirt

Comfortable, casual and loose fitting, our heavyweight dark colour t-shirt will quickly become one of your favorites. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability. Select a design from our marketplace or customise it to make it uniquely yours!

Size & Fit

  • Model is 188 cm and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Imported
  • Machine wash cold

About This Design

Keep Calm Plants Have Protein T-Shirt

Keep Calm Plants Have Protein T-Shirt

Keep Calm Plants Have Protein

Customer Reviews

4.7 out of 5 stars rating32.6K Total Reviews
25521 total 5-star reviews4972 total 4-star reviews1108 total 3-star reviews503 total 2-star reviews472 total 1-star reviews
32,576 Reviews
Reviews for similar products
5 out of 5 stars rating
By Robert C.1 March 2022Verified Purchase
Basic Dark T-Shirt, Black, Adult L
Creator Review
I purchased this to test to see if zazzle was producing good quality. Needless to say, they are. The sizing runs a bit on the small size though. Print quality is perfect. What you see on the screen is what you get.
5 out of 5 stars rating
By Xavier D.3 February 2021Verified Purchase
Basic Dark T-Shirt, Black, Adult M
Creator Review
I like the colours and design, I liked it that much I bought one for myself. Yes the colours and deisgn turned out great. Much better than I expected
5 out of 5 stars rating
By Rachel R.4 September 2025Verified Purchase
Basic Dark T-Shirt, Black, Adult S
Ordered the Irish terrier t shirt. I love it! There was a slight issue with sizing ( my fault) but their customer service was amazing. New t shirt within 5 days. I recommend getting 1 to 2 sizes bigger. I am wearing Men's size large.

Tags

T-Shirts
plantsproteinkeepcalmhaveplantvegandieteatgift
All Products
plantsproteinkeepcalmhaveplantvegandieteatgift

Other Info

Product ID: 235340489353621483
Added on 26/4/22, 11:23 am
Rating: G