Tap / click on image to see more RealViewsTM
$41.30
per pillowcase
 

Hummingbird Bird Flower Floral Creation Pillowcase

Qty:
Standard
Single Pillowcase

Other designs from this category

About Pillowcases

Sold by

Set Size: Single Standard Size Pillowcase

Doze off in serious style with a one-of-a-kind pillowcase. Create a luxourious getaway with this super soft and cozy pillowcase. Counting sheep has never been easier, and sleep never ever felt soooo good.

  • Standard pillowcase dimensions: 20"h x 30"w
  • Made from 100% soft microfibre polyester
  • High quality sublimation printing allows for vibrant colour
  • Double-sided printing available for additional upcharge
  • Pillowcase is printed before being sewn, allowing for beautiful edge-to-edge printing
  • Machine wash/dry
  • Pillow not included
  • Made and shipped from the USA

About This Design

Hummingbird Bird Flower Floral Creation Pillowcase

Hummingbird Bird Flower Floral Creation Pillowcase

Gorgeous collage of botanical fine art of Hummingbird Birds and Flowers by Gould is on this All Creation Sings His Praises Pillowcase. Image is public domain due to expired copyright. Collage is by me.

Customer Reviews

4.9 out of 5 stars rating223 Total Reviews
210 total 5-star reviews9 total 4-star reviews2 total 3-star reviews1 total 2-star reviews1 total 1-star reviews
223 Reviews
Reviews for similar products
5 out of 5 stars rating
By Hendon O.22 October 2023Verified Purchase
Single Pillowcase, Standard Size
Zazzle Reviewer Program
The pillow case was a gift for my youngest daughter’s birthday, featuring her much loved cat. The quality of the material is excellent and the sizing exact with the dimensions of a king size pillow or sometimes referred to a a hotel pillow. As usual the item was manufactured promptly by Zazzle and arrived quickly. The print quality was as described by the automated assessment feature. I chose one of the two photos to use which did not have the high resolution requirements for the print size and this was because I was aware the photo was my daughter’s favorite. I was appropriately warned by the Zazzle system of the issue. The image was still highly acceptable and my daughter adores it.
5 out of 5 stars rating
By R.25 October 2020Verified Purchase
Single Pillowcase, Standard Size
Zazzle Reviewer Program
Bought this for a Christmas present and when received was absolutely amazed! Hands down best present I’ve ever bought for someone. Photos turned up amazing and not blurry at all. Amazing print. Photos weren’t blurry at all for how big they were. Looked amazing
5 out of 5 stars rating
By Jaime L.9 August 2022Verified Purchase
Single Pillowcase, Standard Size
Zazzle Reviewer Program
Fantastic print came out perfectly quality of pillow case is very good. Turned out better than I thought it would am very happy with the finished product

Tags

Pillowcases
All Products
flowersfloralhummingbirdbirdwildlifeanimalsvintagepraisesgodcreation

Other Info

Product ID: 256209242988998924
Added on 26/7/15, 6:26 am
Rating: G