Tap / click on image to see more RealViewsTM
$23.75
per snow globe
 

happy new year 2026 rustic snow globe

Qty:

Other designs from this category

About Snow Globes

Sold by

Style: Dome Snow Globe

Photo Snow Globes are a fun and unique way to showcase your favorite memories, making them the perfect gift for friends and family. There's something truly special about a personalized gift that's made with love.

  • Globe Dimensions: 8.3 cm L x 8.3 cm H
  • Internal Image Sizes: 6 cm L x 7 cm H
  • Acrylic Globe and Base
  • Customizable 2 Sided Print
  • This is not a toy. Recommended for ages 14+
  • Each globe contains a total of 180 ml ounces of water, making these NOT compliant with TSA for carry on packages.

About This Design

happy new year 2026 rustic snow globe

happy new year 2026 rustic snow globe

This wreath motif would look charming inside a new year snow globe 2025. The glitter crystal new year globe feeling appears when you imagine it with snow. It can become a happy new year keepsake gift for nature lovers. The elegant new year snow ball mood matches the pinecones and stars. People enjoy a winter holiday collectible globe that feels peaceful. Overall it turns into a luxury new year gift globe with rustic style.

Customer Reviews

4.0 out of 5 stars rating38 Total Reviews
22 total 5-star reviews6 total 4-star reviews3 total 3-star reviews1 total 2-star reviews6 total 1-star reviews
38 Reviews
Reviews for similar products
5 out of 5 stars rating
By Katelyn S.24 August 2025Verified Purchase
Custom Dome Snow Globe
Early Christmas shopping because I always run out of time, but this picture is perfectly clear and the iridescent flakes in the snow globe are absolutely stunning! Thank you!!! .
from zazzle.com (US)
5 out of 5 stars rating
By Rachel H.10 December 2025Verified Purchase
Custom Dome Snow Globe
Creator Review
Snow Globes are an icon of the holiday season. The quality of this snow globe is impressive. It looks really nice. The sparkling, glittering snow is beautiful and the overall item will make a nice gift for anyone who loves snow globes. .
from zazzle.com (US)
5 out of 5 stars rating
By Mary M.11 December 2025Verified Purchase
Custom Dome Snow Globe
Absolutely very happy with my purchase. Was well worth the price and was done exactly how I ordered it.
from zazzle.com (US)

Tags

Snow Globes
newyearsnowglobe2025glittercrystalnewyearglobehappynewyearkeepsakegiftelegantnewyearsnowballwinterholidaycollectibleglobeluxurynewyeargiftglobestylishholidaydeskdecorblackgoldsnowglobedecorpremiumsnowglobesouvenirglowingnewyearsnowglobe
All Products
newyearsnowglobe2025glittercrystalnewyearglobehappynewyearkeepsakegiftelegantnewyearsnowballwinterholidaycollectibleglobeluxurynewyeargiftglobestylishholidaydeskdecorblackgoldsnowglobedecorpremiumsnowglobesouvenirglowingnewyearsnowglobe

Other Info

Product ID: 256442318044430840
Added on 21/11/25, 11:57 pm
Rating: G