Tap / click on image to see more RealViewsTM
$29.65
per mug
 

Happy Bee Mug

Qty:
Combo Mug
-$3.55
-$1.80
Black

Other designs from this category

About Mugs

Sold by

Style: Combo Mug

Funny, unique, pretty, or personal, it's your choice for the perfect coffee mug. The outside of the mug features a bright white base for your photo, logo, pattern, or saying, while the rim & handle are vividly glazed in rich colour. Match or complement the colour of your existing dinnerware set, or gift your friend a mug in his or her favourite colour.

  • 325 ml or 443 ml
  • Dimensions:
    • 325 ml: 8.1 cm D x 9.7 cm H
    • 443 ml: 8.6 cm D x 11.4 cm H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug.
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Happy Bee Mug

Happy Bee Mug

A cute cartoon bee with a big happy smile waving hello. This is an original illustration by me (not clip art). The motif is repeated on both sides of the mug.

Customer Reviews

4.8 out of 5 stars rating22.2K Total Reviews
19641 total 5-star reviews1896 total 4-star reviews329 total 3-star reviews142 total 2-star reviews227 total 1-star reviews
22,235 Reviews
Reviews for similar products
5 out of 5 stars rating
By DARREN W.6 June 2022Verified Purchase
Combo Mug, 325 ml
Zazzle Reviewer Program
So personal and very much a product of today's market. I personally purchased the Mug for myself to stop others from taking it LOL 😆 However this would make the perfect personalised gift for anyone - I am thinking Work Christmas gift etc I like my coffee so I only wish the mug was slightly bigger. The Avatar I choose came out PERFECTLY it really does look spot on.
5 out of 5 stars rating
By DARRIN W.14 July 2024Verified Purchase
Combo Mug, 325 ml
Very well made, great mug and the the me emoji 👍. Excellent printing on this very well made mug, love it👍👍
5 out of 5 stars rating
By Joel G.26 August 2021Verified Purchase
Combo Mug, 444 ml
Zazzle Reviewer Program
Great product, good delivery time, and an awesome idea for a gift! It was even better than I could have imagined, the customisation is incredible. The colour is perfect, it's dishwashable and microwaveable, the text print on the mug looks exactly like I wanted it to look and best of all, it's a large sized mug that you can drink plenty of coffee or whatever you want! I gifted this to my father and he loves it. He drinks coffee with that mug everyday :) I recommend.

Tags

All Products
beehappycutehoneybumbleflywaspinsectwildlifeanimals

Other Info

Product ID: 168668466921023645
Added on 14/1/09, 3:41 pm
Rating: G