Tap / click on image to see more RealViewsTM
$51.60
per shirt
 

Guardian Ancestor Hypatia, Women's T-Shirt

Qty:
Womens Basic T-Shirt
+$22.50
+$48.50
Black
Classic Printing: No Underbase
-$10.20
-$10.20
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft – a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customise it and unleash your creativity!

Size & Fit

  • Model is 5'7"/170 cm and is wearing a Small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Tagless label for comfort
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Guardian Ancestor Hypatia, Women's T-Shirt

Guardian Ancestor Hypatia, Women's T-Shirt

Guardian Ancestor Hypatia of Alexandria T-Shirt By Cherry Hill Seminary www.CherryHillSeminary.org Image Credit: "Hypatia by Julius Kronberg, 1889" (public domain) (BusDM)

Customer Reviews

4.6 out of 5 stars rating15K Total Reviews
10651 total 5-star reviews2896 total 4-star reviews841 total 3-star reviews384 total 2-star reviews256 total 1-star reviews
15,028 Reviews
Reviews for similar products
5 out of 5 stars rating
By Ritz M.14 December 2020Verified Purchase
Womens Basic T-Shirt, White, Adult M
Zazzle Reviewer Program
Love how the print turn out for an affordable price. My tshirt looks really good
5 out of 5 stars rating
By Lili T.24 October 2025Verified Purchase
Womens Basic T-Shirt, White, Adult S
Good quality and clear photo.
5 out of 5 stars rating
By H.17 October 2021Verified Purchase
Womens Basic T-Shirt, Black, Adult S
Zazzle Reviewer Program
Look i bought this t-shirt for my wifey in a small. Its was way to small, it must of been a small fit. I wrote to Zazzle and they fixed it immediately and I received a new T very promptly. My wife absolutely adores it and says it’s so very comfortable. 10/10 Thanks Zazzle. Excellent printing, excellent color Actually its a excellent T-Shirt . Im so glad a found Zazzle im very impressed

Tags

All Products
paganpaganismmagickmagicwitchcraftwiccafaithreligionspiritualityseminary

Other Info

Product ID: 256365616848291214
Added on 28/3/25, 4:19 am
Rating: G