Tap / click on image to see more RealViewsTM
Sale Price $43.86.  
Original Price $51.60 per shirt
You save 15%

Guardian Ancestor Hypatia, Women's T-Shirt

Qty:
Womens Basic T-Shirt
+$22.50
+$48.50
Black
Classic Printing: No Underbase
-$10.20
-$10.20
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft – a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customise it and unleash your creativity!

Size & Fit

  • Model is 5'7"/170 cm and is wearing a Small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Tagless label for comfort
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Guardian Ancestor Hypatia, Women's T-Shirt

Guardian Ancestor Hypatia, Women's T-Shirt

Guardian Ancestor Hypatia of Alexandria T-Shirt By Cherry Hill Seminary www.CherryHillSeminary.org Image Credit: "Hypatia by Julius Kronberg, 1889" (public domain) (BusDM)

Customer Reviews

4.5 out of 5 stars rating15.1K Total Reviews
10706 total 5-star reviews2902 total 4-star reviews845 total 3-star reviews388 total 2-star reviews264 total 1-star reviews
15,105 Reviews
Reviews for similar products
5 out of 5 stars rating
By Ritz M.14 December 2020Verified Purchase
Womens Basic T-Shirt, White, Adult M
Zazzle Reviewer Program
Love how the print turn out for an affordable price. My tshirt looks really good
5 out of 5 stars rating
By Lili T.24 October 2025Verified Purchase
Womens Basic T-Shirt, White, Adult S
Good quality and clear photo.
5 out of 5 stars rating
By J.27 December 2020Verified Purchase
Womens Basic T-Shirt, White, Adult L
Zazzle Reviewer Program
The Shirt says it all - it is exactly as I wanted it and I couldn't be happier. This is a 10 out of 10 shirt. Ticks all the boxes. Thank you again Zazzle. No issues with the printing. It was perfect

Tags

All Products
paganpaganismmagickmagicwitchcraftwiccafaithreligionspiritualityseminary

Other Info

Product ID: 256365616848291214
Added on 28/3/25, 4:19 am
Rating: G