Tap / click on image to see more RealViewsTM
Sale Price $36.60.  
Original Price $43.05 per shirt
You save 15%

Guardian Ancestor Hypatia, Men's T-Shirt

Qty:
Value T-Shirt
+$2.45
+$2.45
+$19.60
Black
Classic Printing: No Underbase
-$4.10
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Men's Value T-Shirt

This classic silhouette is an affordable alternative heavyweight t-shirt for the value-conscious consumer. Rest assured as this t-shirt is pre-shrunk and made from 100% cotton. It also has double-needle stitched bottom and hems for extra durability.

Size & Fit

  • Model is 6'2"/188 cm and is wearing a Medium
  • Standard fit
  • Fits true to size

Fabric & Care

  • 5.4 oz. 100% cotton
  • 1x1 rib knit collar and shoulder-to-shoulder taping
  • Double-needle hem
  • Imported
  • Machine wash cold

About This Design

Guardian Ancestor Hypatia, Men's T-Shirt

Guardian Ancestor Hypatia, Men's T-Shirt

Guardian Ancestor Hypatia of Alexandria T-Shirt By Cherry Hill Seminary www.CherryHillSeminary.org Image Credit: "Hypatia by Julius Kronberg, 1889" (public domain) (BusDM)

Customer Reviews

4.7 out of 5 stars rating32.6K Total Reviews
25514 total 5-star reviews4972 total 4-star reviews1108 total 3-star reviews502 total 2-star reviews472 total 1-star reviews
32,568 Reviews
Reviews for similar products
5 out of 5 stars rating
By C.4 June 2021Verified Purchase
Value T-Shirt, White, Adult L
Zazzle Reviewer Program
Happy with order it turned up faster than speculated. Printing was good looks great happy with picture and writing
5 out of 5 stars rating
By C.24 December 2021Verified Purchase
Value T-Shirt, White, Adult S
Zazzle Reviewer Program
This shirt was way better than I thought it would be the shirt fit perfectly and it arrived very very quickly it took less than a week, there was no issues with the products and I highly recommend it!! The printing tuned out perfectly and didn’t feel fake and tacky!
5 out of 5 stars rating
By Jesse J.6 September 2020Verified Purchase
Basic Dark T-Shirt, Black, Adult L
Zazzle Reviewer Program
This is the first time I have experimented with some of my art on a shirt. I will be trying a few designs to see what works best. I am thrilled with the result. Premium quality results. Now I just need to wait and see how the picture quality will cope with multiple washes. Amazed and incredibly satisfied with the shirt.

Tags

All Products
paganpaganismmagickmagicwitchcraftwiccafaithreligionspiritualityseminary

Other Info

Product ID: 256979745856406409
Added on 28/3/25, 4:14 am
Rating: G