Tap / click on image to see more RealViewsTM
$87.85
per watch
 

Green Woman - Wood Watch

Qty:
Classic Brown Leather
+$9.80
+$9.80
+$59.15
+$59.15
+$59.15

About Watches

Sold by

Style: Women's Classic Brown Leather Strap Watch

The Women's Classic Leather Watch is the definition of timeless style. Designed with croc-embossed leather straps and a silver alloy case, this watch exudes sophistication. Personalise it with your favourite design or text for a time piece that is as stylish as you are!

  • Women's wrist watch
  • Material:
    • Case: Alloy
    • Strap: Leather
  • Dimensions:
    • Face: 2.3 cm diameter
    • Strap: 20.3 cm x 1.4 cm
    • Case: 2.7 cm diameter
    • Weight: 28.1 g
  • 3-hand analog Japan Quartz®
  • Also available with a brown leather strap
  • Full colour custom printing on face
  • Buckle closure
  • Water Resistance: Up to 3 ATM (30 metres)
  • 1 year manufacturers limited warranty
  • Battery included
  • This product is recommended for ages 13+

About This Design

Green Woman - Wood Watch

Green Woman - Wood Watch

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the centre of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolising her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.6 out of 5 stars rating1.3K Total Reviews
1008 total 5-star reviews146 total 4-star reviews29 total 3-star reviews22 total 2-star reviews70 total 1-star reviews
1,275 Reviews
Reviews for similar products
5 out of 5 stars rating
By D.15 October 2015Verified Purchase
Watch, Rhinestone Black Enamel
Zazzle Reviewer Program
The watch is beautiful! Exactly how I imagined the final product to be. It is very sleek and classic and it's a watch that only I have because I personalized the face. The only gripe I have is that the buckle and the rim of the watch face are different colors and finishing. The buckle is gold with a shiny finish while the rim of the watch face is silver with a matte finish. But honestly, the buckle and the face will never be seen on the same side of my wrist AND it's a fun trait that contributes to its specialness:-). The colors are a bit lighter than my original photo but it's definitely still acceptable! The quality is great, I can read the tiny words that I included in the numbers, which was my main concern. 100% would recommend to my friends and family!
from zazzle.com (US)
5 out of 5 stars rating
By Denise B.24 March 2018Verified Purchase
Watch, Silicone Strap White
Creator Review
I like the illustrative watch with the lady on it. It is a great reminder that I am blessed and it has a very sturdy leather band. The colors are true and vibrant. Love the color of the Leather also. Very nice.
from zazzle.com (US)
5 out of 5 stars rating
By Debra M.4 March 2019Verified Purchase
Watch, Black Vintage Leather
Creator Review
I love Charles Russell art, and especially this painting of a bronco and cowboy. This watch is perfect with blue jeans and sweatshirts! I've gotten quite a few good comments when I wear it. Better than I expected! Amazing that a painting can be so clear on such a small canvas, but this worked out really well. I really like it.
from zazzle.com (US)

Tags

Watches
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca

Other Info

Product ID: 256736500950724343
Added on 23/4/25, 10:48 am
Rating: G