Tap / click on image to see more RealViewsTM
$118.83
each
 

Green Woman - Wood Sherpa Blanket

Qty:
Personalise this template

Other designs from this category

About Sherpa Blankets

Sold by

Size: Medium

Cuddle up to warmth and comfort in our most luxurious blanket yet, the Sherpa fleece blanket. Perfect for those nights when your baby says "It's cold outside!"

  • Available in 3 different sizes: small (76.2 cm x 101.6 cm); medium (127 cm x 152.4 cm); large (152.4 cm x 203.2 cm)
  • Blanket features vividly customised image on one side and the softest Sherpa available on the reverse
  • Material: 100% polyester printed mink with ultra-soft sherpa backing
  • Sherpa side is non-customisable and the colour is off-white
  • Edge-to-edge sublimation printing in vibrant full colour
  • Sturdy hand sewn edge stitching for a clean finish
  • Machine wash separately with warm water, gentle cycle, mild detergent
  • Tumble dry low; do not iron or dry clean
  • Wash before first use
  • This product is recommended for ages 2+

About This Design

Green Woman - Wood Sherpa Blanket

Green Woman - Wood Sherpa Blanket

A Green Woman carved in wood with paint applied to the oak leaves and hair. Customise by adding your own text. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the centre of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolising her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.8 out of 5 stars rating361 Total Reviews
318 total 5-star reviews24 total 4-star reviews8 total 3-star reviews5 total 2-star reviews6 total 1-star reviews
361 Reviews
Reviews for similar products
5 out of 5 stars rating
By Ms D.13 December 2022Verified Purchase
Medium
Zazzle Reviewer Program
The blanket is outstanding quality. More than I expected. I recommend to product for a gift or for yourself. Soft and cozy. I satisfied with the image quality, exceded my expectations. Amazing... very happy with product. I'll be ordering again...
5 out of 5 stars rating
By V.12 August 2021Verified Purchase
Small
Zazzle Reviewer Program
The blanket arrived very quickly. It's very good quality and the print work is very good. I ordered a large and it was exactly the dimension advertised. I actually made a mistake the first time and I was able to cancel it even after I placed the order. I received a prompt response from the company after requesting their help. Overall very satisfied with the quality and service provided... so I have ordered 3 more blankets :). Excellent... website promptly told me that my picture would be blurry etc so I was able to fix it and changed the design to prevent getting a blurry blanket before I ordered.
5 out of 5 stars rating
By Peter R.9 May 2024Verified Purchase
Small
I was told the picture may be blurred but its not great product

Tags

Sherpa Blankets
green womangreen manwild mancustomnature religionarchitecturemediaevalfertilitywiccaenvironment
All Products
green womangreen manwild mancustomnature religionarchitecturemediaevalfertilitywiccaenvironment

Other Info

Product ID: 256441961554307293
Added on 1/5/25, 9:09 am
Rating: G