Tap / click on image to see more RealViewsTM
$34.15
per keychain
 

Green Woman - Wood Key Ring

Qty:
Premium Round
-$22.35
-$23.35
-$22.35
Small (3.7 cm)

Other designs from this category

About Keychains

Sold by

Style: Premium Round Keychain

Keep your keys safe and spectacular with a round keyring from Zazzle. You can customise it with designs, photographs, or text. These keyrings are waterproof and have a UV coating that will protect any image or design you add.

  • Dimensions:
    • Diameter: 3.66 cm
    • Depth: 0.28 cm
    • Weight: 20 g
  • Full-colour, full-bleed printing
  • Silver coloured metal charm & ring
  • UV resistant and waterproof
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 2.95 cm x 2.95 cm. For best results please add 0.16 cm bleed

About This Design

Green Woman - Wood Key Ring

Green Woman - Wood Key Ring

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the centre of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolising her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.6 out of 5 stars rating5.6K Total Reviews
4328 total 5-star reviews798 total 4-star reviews219 total 3-star reviews118 total 2-star reviews100 total 1-star reviews
5,563 Reviews
Reviews for similar products
5 out of 5 stars rating
By W.26 February 2024Verified Purchase
Premium Round Keychain, Small (3.65 cm)
Zazzle Reviewer Program
Awesome Keyring in Every Way Looks Fantastic and a Quality Finish that will stand out. I accidentally orded the larger size, not realising how big it would be. So I immediately ordered 2 more in the smaller size and the Quality finish is the same. Will Not waste the 2 larger ones, I already have one hanging from my Car rearview mirror & the second one will be mounted on my Boat Dashboard near the Helm. The Quality Finish on Both sizes is Amazing and I would recommend these Keyrings on Any Day Purchase one and be Amazed
5 out of 5 stars rating
By W.2 March 2024Verified Purchase
Premium Round Keychain, Small (3.65 cm)
I'm Now a Huge Fan! I have Purchased Both sizes, & the Quality is Astounding. I'm going to show this off to All my Friends at Every Opportunity. The Printing Work on Both Sizes looks Awsome & The Keyrings look Exactly like the Advertised pictures. Buy one & you'll Be as Happy as I am
5 out of 5 stars rating
By Tracey C.2 October 2022Verified Purchase
Metal Circle Keychain, 5.08 cm
Zazzle Reviewer Program
This keyring is beautiful and a wonderful end of year thankyou gift for any coach. I would recommend purchasing the larger size, I originally purchased the smaller size and it was so small I could hardly read the names on it. The larger size is much easier to read. Printing turned out wonderful.

Tags

Keychains
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca

Other Info

Product ID: 256756199699760004
Added on 23/4/25, 10:01 am
Rating: G