Tap / click on image to see more RealViewsTM
$6.85
per bottle opener
 

Green Woman - Wood Bottle Opener

Qty:
Heads-up!
Sorry, this product is completely sold out.

Other designs from this category

About Bottle Opener

Sold by

Style: Bottle Opener

Make all your bottle openers fancy with Zazzle! Customise this magnet-backed bottle opener with your favourite images, designs, or text! Made to “stick" to any metal surface, this bottle opener looks great on your refrigerator, is perfect for parties, and makes an even better gift!

  • Dimensions: 5.7 cm diameter
  • Print area covered with scratch and UV-resistant Mylar
  • Opens standard beer and soft drink cap bottles
  • Made in U.S.A.

About This Design

Green Woman - Wood Bottle Opener

Green Woman - Wood Bottle Opener

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the centre of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolising her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.8 out of 5 stars rating159 Total Reviews
136 total 5-star reviews18 total 4-star reviews3 total 3-star reviews1 total 2-star reviews1 total 1-star reviews
159 Reviews
Reviews for similar products
5 out of 5 stars rating
By Maryanne O.24 November 2020Verified Purchase
Bottle Opener
Zazzle Reviewer Program
This great personalised bottle opener makes the perfect gift. It's compact and with the magnetic backing sits nicely on the fridge for display and won't get lost. Great gift idea with a favourite bottle of beer. The layout and quality of the photo is fantastic.
5 out of 5 stars rating
By Karen B.1 February 2024Verified Purchase
Bottle Opener
Zazzle Reviewer Program
Loved the quality of the opener. Very vibrant colors & especially liked the strong magnets. Absolutely recommend this. Very vibrant. Love it! Great gift
from zazzle.com (US)
5 out of 5 stars rating
By Anonymous17 September 2025Verified Purchase
Bottle Opener
I put them in the gift bags and everyone loved them at the baby shower!!! They were adorable! ♥️.
from zazzle.com (US)

Tags

Bottle Opener
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca

Other Info

Product ID: 256250449226593531
Added on 23/4/25, 10:30 am
Rating: G