Tap / click on image to see more RealViewsTM
$4.40
per badge
 

Green Woman - Wood 3 Cm Round Badge

Qty:
Round Badge
+$2.65
+$1.50
Small, 3.2 cm (1.25")

Other designs from this category

About badges

Sold by

Shape: Round Badge

With Zazzle badges buttons, you can do more than just express a political opinion. Since you can add your own designs, pictures, and text, you can express just about anything you can think of. Start creating amazing flair today!

  • Available in 5 sizes from 3.18 cm to 15.24 cm diameter
  • Covered with scratch and UV-resistant Mylar
  • Square buttons available too
  • Made in the U.S.A.
  • This product contains a functional sharp point. Not for children under 3 years of age

About This Design

Green Woman - Wood 3 Cm Round Badge

Green Woman - Wood 3 Cm Round Badge

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the centre of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolising her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.8 out of 5 stars rating8.5K Total Reviews
7637 total 5-star reviews636 total 4-star reviews132 total 3-star reviews54 total 2-star reviews69 total 1-star reviews
8,528 Reviews
Reviews for similar products
5 out of 5 stars rating
By Siti H.6 August 2022Verified Purchase
Round Badge, Standard, 5.7 cm (2.25")
Zazzle Reviewer Program
This badge I ordered for my work mate. It’s so cute and perfectly done. I’m very happy with how it’s turn out. Thanks. The color was exactly as the picture on the advertisement. It is good quality print, for the price I paid, I’m very happy with the product. Thanks so much.
5 out of 5 stars rating
By Ah F.17 November 2019Verified Purchase
Round Badge, Standard, 5.7 cm (2.25")
Zazzle Reviewer Program
The product looks so beautiful!!! Thank you so much, you did a great job printing it. It has everything I ever wanted and the shiny finish is just perfect. The metal back really complements the picture. Thank You! ;). The image was great. All the colours were there and the writing was readable.
5 out of 5 stars rating
By Kinsey B.19 May 2024Verified Purchase
Round Badge, Small, 3.2 cm (1.25")
I got the 5.7 cm (2.25") badge and it was very large! (In a good way). Printing was great - ordered for me and a friend, she was very happy with it. Printing was amazing - not off-center or just bad quality

Tags

badges
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymediaevalpaganwicca

Other Info

Product ID: 256305253868111648
Added on 23/4/25, 9:56 am
Rating: G