Tap / click on image to see more RealViewsTM
$11.65
per set of 6 labels
 

Green Watercolor Wedding Table Number Wine Label

Qty:
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
-$1.95
-$3.90
+$7.80
+$7.80
+$7.80
+$7.80
+$7.80

Other designs from this category

About Food and Beverage Label Sets

Sold by

Style: Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")

Easily customise a bottle of wine and make it 100% your own by adding a label! Perfect for weddings, bachelor parties and birthday parties.

  • Dimensions: 8.9 cm x 10.1 cm; fits most standard sized wine bottles
  • Each set includes 6 matte labels
  • Scratch-resistant and waterproof
  • Vibrant, full-colour, photo-quality printing that stands the test of time
  • Easy peel-and-stick method; labels are easily applied by removing the crack and peel backing to expose the permanent adhesive
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 8.9 cm x 10.1 cm. For best results please add a 3 mm bleed.

About This Design

Green Watercolor Wedding Table Number Wine Label

Green Watercolor Wedding Table Number Wine Label

Make a statement at your wedding or event tables with our beautiful green watercolor table number wine labels. The design features a delicate watercolor motif in shades of green, adding a natural and elegant touch to your table setting. The labels are fully customisable. These table number labels are perfect to put on wine bottles, or any other beverage, as a way to indicate table numbers. These table number labels are printed on high-quality, waterproof and adhesive material, making it easy to stick and display on your bottles. Impress your guests with our stunning green watercolor table number wine labels at your special event.

Customer Reviews

4.9 out of 5 stars rating611 Total Reviews
565 total 5-star reviews27 total 4-star reviews4 total 3-star reviews5 total 2-star reviews10 total 1-star reviews
611 Reviews
Reviews for similar products
5 out of 5 stars rating
By J.29 October 2023Verified Purchase
Mini Sparkling Wine Bottle Labels (7.6 cm x 5.1 cm)
Zazzle Reviewer Program
The labels were applied easily and looked great. No puckering or bubbles. Better quality than some professional labelling companies I have dealt with. The colours were true to what I ordered. Excellent quality printing.
5 out of 5 stars rating
By Jenine P.31 July 2022Verified Purchase
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
Zazzle Reviewer Program
We used these labels as our wedding invitations on bottles of champagne, with the instruction to bring on the day. Everyone loved the idea. The labels were well made, looked expensive and stuck to the bottle well.
5 out of 5 stars rating
By S.13 August 2021Verified Purchase
Zazzle Reviewer Program
This was exactly what I hoped for. Good quality, easy to peal the sticker off & covers the label of a wine bottle perfectly. Good colour and easy to read
Original product

Tags

Food and Beverage Label Sets
greenelegantbohocalligraphyweddingfancydarkclassicfairytale
All Products
greenelegantbohocalligraphyweddingfancydarkclassicfairytale

Other Info

Product ID: 256730755502215084
Added on 27/1/23, 7:57 am
Rating: G