Tap / click on image to see more RealViewsTM
$5.15
per sticker
 

Great Seal of the Republic of the Philippines

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Small 7.62 cm x 7.62 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 7.62 cm L x 8.89 cm H
  • Design Area: 7.62 cm L x 7.62 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Great Seal of the Republic of the Philippines

Great Seal of the Republic of the Philippines

The Philippines is an emerging market and a developing and newly industrialised country, whose economy is transitioning from being agricultural to service- and manufacturing-centred.

Customer Reviews

4.5 out of 5 stars rating114 Total Reviews
91 total 5-star reviews8 total 4-star reviews2 total 3-star reviews5 total 2-star reviews8 total 1-star reviews
114 Reviews
Reviews for similar products
5 out of 5 stars rating
By Sheila J.5 June 2022Verified Purchase
Large 20.32 cm x 20.32 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
All the kiss-cut stickers we've ordered have been perfect -- great quality stickers and always well cut. The colors on these watercolor heart stickers really pop and are very pretty! We're using them as envelope seals on cellulose packages.
from zazzle.com (US)
5 out of 5 stars rating
By Anonymous7 August 2025Verified Purchase
This design is delightful! As pretty in person as on the site. I thought it looked best applied with a white background behind it! Would recommend!!!
from zazzle.com (US)
5 out of 5 stars rating
By Susan K.5 July 2024Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
This label did not contain any errors as the large one did. Again, this label did not contain any errors of the large one did
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
All Products
philippinesflagtravelpilipinasmanilastickersfilipinoquezon citycoat of armscountry seals

Other Info

Product ID: 256996505248596382
Added on 24/6/25, 11:54 am
Rating: G