Tap / click on image to see more RealViewsTM
$14.70
per set of 3 sheets
 

God Speed Edmund Leighton Fine Art Mediaeval Wrapping Paper Sheet

Qty:

Other designs from this category

About Wrapping Paper Sheet Sets

Sold by

Size: 48 cm x 73 cm

Our beautifully printed wrapping paper comes in a set of three conveniently pre-cut sheets. Ideal for gift wrapping, party favors, or making your next creative DIY crafting project really stand out! These flat wraps are better than traditional rolls of wrapping paper because they don't roll back on themselves, and the convenient guideline grids on the back of each and every sheet allows you to effortlessly line up your gifts on them, and then make a perfect fold every time. And because they are flat and easy to store, they are ideal for those last-minute presents - say goodbye to pulling those old fashioned crushed and ruined paper rolls out of the closet!

  • Sold in sets of 3
  • Each sheet is customisable! Mix and match designs to create unique combinations
  • Dimensions: (3) 49 cm x 72 cm sheets
  • Printed on heavyweight 70 lb. uncoated matte or 80 lb. semi-gloss paper
  • Back side features grid guidelines for precise wrapping
  • Use individually or together for a creative gift presentation
  • Lay flat edges make these sheets ideal for DIY crafts and projects, such as decoupage, matting, or even scrapbooking
  • Sheets come loosely rolled, and are crease-free

About This Design

God Speed Edmund Leighton Fine Art Mediaeval Wrapping Paper Sheet

God Speed Edmund Leighton Fine Art Mediaeval Wrapping Paper Sheet

Edmund Leighton - God Speed. Oil on Canvas. Year: 1900, Public domain.

Customer Reviews

4.8 out of 5 stars rating1.1K Total Reviews
1030 total 5-star reviews53 total 4-star reviews16 total 3-star reviews4 total 2-star reviews22 total 1-star reviews
1,125 Reviews
Reviews for similar products
5 out of 5 stars rating
By Cat S.9 October 2024Verified Purchase
48 cm x 73 cm Wrapping Paper Sheets, Matte 48.26 cm x 73.66 cm
Beautiful woodland animal design on good quality paper. Love the grid design on the reverse side that makes it so easy to cut straight. Expertly packed so it arrived safely to Australia in 7 days from posting. Very Happy, thank you! .
5 out of 5 stars rating
By Stephanie S.28 January 2026Verified Purchase
48 cm x 73 cm Wrapping Paper Sheets, Matte 48.26 cm x 73.66 cm
Creator Review
Heavy enough for for light weight poster art. Light enough for heavyweight decoupage. The perfect versatile print and all of the finer details of the artwork was picked up quite magnificently! .
5 out of 5 stars rating
By J.5 January 2023Verified Purchase
48 cm x 73 cm Wrapping Paper Sheets, Matte 48.26 cm x 73.66 cm
Zazzle Reviewer Program
I used this paper in frames as artwork! Looks beautiful! Still have one large print to frame. Excellent quality!!!

Tags

Wrapping Paper Sheet Sets
All Products
leightonwarknightmaidenmediaevalfantasyfine artlovecastlehorse

Other Info

Product ID: 256420946038786223
Added on 4/8/23, 1:18 am
Rating: G