Tap / click on image to see more RealViewsTM
$48.80
per planner
 

God Speed Edmund Leighton Fine Art Mediaeval Planner

Qty:
Black

Other designs from this category

About Planners

Sold by

Size: Standard (21.6 cm x 27.9 cm)

It's time to get organised! Plan your days in style with the help of a customisable planner. Perfect for your busy lifestyle, this planner has a place to plan your months, plan your weeks, and write down everything that's important to you!

  • Dimensions: 21.59 cm x 27.94 cm
  • One sheet of fun and colourful repositionable stickers in back (shown)
  • Includes monthly and weekly layouts, 12 months, 60 pages
  • Softcover front and back covers laminated
  • Wire-o® spiral spine available in three colour options
Fully committed to providing high quality and safe products, this product is Consumer Product Safety Improvement Act (CPSIA) compliant. Tracking label available on inside back cover.

About This Design

God Speed Edmund Leighton Fine Art Mediaeval Planner

God Speed Edmund Leighton Fine Art Mediaeval Planner

Edmund Leighton - God Speed. Oil on Canvas. Year: 1900, Public domain.

Customer Reviews

4.7 out of 5 stars rating302 Total Reviews
260 total 5-star reviews25 total 4-star reviews3 total 3-star reviews3 total 2-star reviews11 total 1-star reviews
302 Reviews
Reviews for similar products
5 out of 5 stars rating
By Ekaterina R.18 September 2019Verified Purchase
Small (14 cm x 21.6 cm), Soft Cover, Gold Spiral Planner
Creator Review
Am anaizing weekly planner. The quality is just perfect. The picture is wonderful and bright. I am 100% satisfied and this product 100% recommended. The planner is light and flexible. Easy to carry in a bag. The image quality is 100%. Colours are 100% perfect. amazing design !!!
5 out of 5 stars rating
By Sharon B.14 March 2021Verified Purchase
Standard (21.6 cm x 27.9 cm), Soft Cover, Gold Spiral Planner
Zazzle Reviewer Program
I love that I can put all our medical appointments and relevant paperwork in this book and take it with me to the doctors. It allows for notes, plenty of space and easy to create events. It’s also really pretty so can stay out and not look out of place. It comes with stickers for special events, seriously fun. Beautiful, colourful, fun and exactly as I asked for.
5 out of 5 stars rating
By Leah M.2 January 2024Verified Purchase
Standard (21.6 cm x 27.9 cm), Soft Cover, Gold Spiral Planner
Zazzle Reviewer Program
Product arrived on time and in great condition (no damage). The photos were the same colour and clarity as seen on my computer screen. Would 100% recommend this product. Perfect! Colour, quality and clarity of images is fantastic

Tags

Planners
leightonwarknightmaidenmediaevalfantasyfine artlovecastlehorse
All Products
leightonwarknightmaidenmediaevalfantasyfine artlovecastlehorse

Other Info

Product ID: 256869878912485903
Added on 13/1/24, 12:00 am
Rating: G