Tap / click on image to see more RealViewsTM
$33.15
per spiral notebook
 

God Speed Edmund Leighton Fine Art Mediaeval Notebook

Qty:
21.59 cm x 27.94 cm Deluxe Spiral Notebook
Wide Ruled
Black

Other designs from this category

About Spiral Notebooks

Sold by

Style: 21.59 cm x 27.94 cm Deluxe Spiral Notebook

Accessorise while you organise with these hand made spiral notebooks. The front and back covers are customisable with your images and text, and the notebook covers are laminated to ensure durability. Choose from 4 notebook styles, hardcover or softcover versions, 7 different spiral colours and 10 page design options to make your one-of-a-kind notebook today.

  • Dimensions: 21.6 cm l x 28 cm w
  • Hardcover or Softcover
  • Page Count: 60 sheets, 120 pages
  • 60 lb. durable text smooth paper
  • Laminated front and back covers, plain white inside
  • Choice of 7 colours for the spiral
  • Choice of 10 designs for the pages
  • CPSIA compliant
  • Suitable for ages 4+

About This Design

God Speed Edmund Leighton Fine Art Mediaeval Notebook

God Speed Edmund Leighton Fine Art Mediaeval Notebook

Edmund Leighton - God Speed. Oil on Canvas. Year: 1900, Public domain.

Customer Reviews

4.8 out of 5 stars rating842 Total Reviews
763 total 5-star reviews57 total 4-star reviews7 total 3-star reviews4 total 2-star reviews11 total 1-star reviews
842 Reviews
Reviews for similar products
5 out of 5 stars rating
By Melanie C.2 August 2020Verified Purchase
21.59 cm x 27.94 cm Deluxe Spiral Notebook, Black spiral, Wide Ruled pages
Zazzle Reviewer Program
Of all the online options for personalised notebooks this was the most adaptable and an amazing price. Made the perfect personalised first paper anniversary gift. Perfect,& high quality thick gloss cover
5 out of 5 stars rating
By J.30 May 2023Verified Purchase
21.59 cm x 21.59 cm Deluxe Spiral Notebook, Gold spiral, Sketch pages
Zazzle Reviewer Program
Personalising my product was super easy. I loved that you could see the preview updating as you edited the product, and also that you could choose from many different fonts and which border for the inside pages. I’ve never seen a guest book with a lovely image before, only really with the words ‘Guest Book.’ The whole process was great and the product is beautiful! The printing is fantastic! I love the gloss cover, the inside pages are also beautiful. The printing is very clear. Looks just as shown on the website.
5 out of 5 stars rating
By P.8 October 2022Verified Purchase
21.59 cm x 21.59 cm Deluxe Spiral Notebook, White spiral, Sketch pages
Zazzle Reviewer Program
Perfect as a Family Gift as a Surprise to make their 💖smile at any time of the year, I customised with our own Photos and we love them, this is such a great gift to give to everyone you love💖💖💖💖💖. Absolutely beautiful, thank you

Tags

Spiral Notebooks
leightonwarknightmaidenmediaevalfantasyfine artlovecastlehorse
All Products
leightonwarknightmaidenmediaevalfantasyfine artlovecastlehorse

Other Info

Product ID: 256225330556941399
Added on 1/8/23, 7:35 am
Rating: G