Tap / click on image to see more RealViewsTM
$8.10
per magnet
 

God Speed Edmund Leighton Fine Art Mediaeval Magnet

Qty:
Rectangle Magnet
-$2.20
-$1.25
6.4 cm x 8.9 cm

Other designs from this category

About Magnets

Sold by

Shape: Rectangle Magnet

Your refrigerator called and said it was feeling mighty lonely. Why not give it a few friends to play with by creating a couple of custom magnets! Add your favorite image to a round magnet, or shop the thousands of options for a cool square magnet.

  • Available in 8.9 cm x 6.4 cm or 6.4 cm x 8.9 cm
  • USA Made with recycled domestic steel
  • Smooth glossy mylar finish
  • Printed on FSC Certified recycled paper stock

About This Design

God Speed Edmund Leighton Fine Art Mediaeval Magnet

God Speed Edmund Leighton Fine Art Mediaeval Magnet

Edmund Leighton - God Speed. Oil on Canvas. Year: 1900, Public domain.

Customer Reviews

4.8 out of 5 stars rating7K Total Reviews
6232 total 5-star reviews580 total 4-star reviews119 total 3-star reviews46 total 2-star reviews43 total 1-star reviews
7,020 Reviews
Reviews for similar products
5 out of 5 stars rating
By Delores C.13 August 2025Verified Purchase
Magnet, Style: Rectangle Magnet, Size: 8.9 cm x 6.4 cm
Creator Review
The magnet is sturdy and bright and the print quality is great! .
from zazzle.com (US)
5 out of 5 stars rating
By Delores C.13 August 2025Verified Purchase
Magnet, Style: Rectangle Magnet, Size: 6.4 cm x 8.9 cm
Creator Review
The magnet is sturdy and bright and the print quality is great! .
from zazzle.com (US)
5 out of 5 stars rating
By Caroline W.28 December 2024Verified Purchase
Magnet, Style: Circle, Size: Standard, 5.7 Cm
The magnet is a good size and the picture of the Momotaro family is very clear and awesome! I highly recommend the magnets!
from zazzle.com (US)

Tags

Magnets
leightonwarknightmaidenmediaevalfantasyfine artlovecastlehorse
All Products
leightonwarknightmaidenmediaevalfantasyfine artlovecastlehorse

Other Info

Product ID: 256868322552475579
Added on 1/8/23, 7:12 am
Rating: G