Tap / click on image to see more RealViewsTM
$55.15
per pet bowl
 

Glitch senor funpickle cubimal bowl

Qty:
  1. Style

About Pet Bowls

Sold by

Style: Medium Pet Bowl

Every pet needs a custom bowl from Zazzle! Printed with your favourite photos, text and designs, your pet will love our 100% ceramic bowls. Dishwasher and microwave approved, this medium bowl is as safe as it is easy to keep clean!

  • 6.4 cm tall, 14.6 cm diameter.
  • Dishwasher and microwave safe.
  • Printed in and shipped from the USA.
  • Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 4.4 cm x 48.9 cm.

About This Design

Glitch senor funpickle cubimal bowl

Glitch senor funpickle cubimal bowl

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.8 out of 5 stars rating430 Total Reviews
374 total 5-star reviews37 total 4-star reviews11 total 3-star reviews1 total 2-star reviews7 total 1-star reviews
430 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tracey C.20 July 2021Verified Purchase
Medium Pet Bowl
Zazzle Reviewer Program
The bowl was exactly as the picture looked. The quality was better than I expected. The colours and the printing were exactly as ordered.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jamie W.5 August 2026Verified Purchase
Large Pet Bowl
Quite a collection of bowls :).
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Caroline31 January 2020Verified Purchase
Medium Pet Bowl
Zazzle Reviewer Program
Easy to wash good quality great photo writing to read well easy to use arrived fast well packed up in box for postage. Very easy to read clear well done in printing it

Tags

Pet Bowls
senorfunpicklefunpicklecubimalglitchglitchentinyspeckglitchthegamewetdryvac
All Products
senorfunpicklefunpicklecubimalglitchglitchentinyspeckglitchthegamewetdryvac

Other Info

Product ID: 215943300112242663
Added on 23/11/13, 5:46 pm
Rating: G