Tap / click on image to see more RealViewsTM
$50.15
per apron
 

Glitch scion of purple cubimal standard apron

Qty:
  1. colour

  2. Size

Other designs from this category

About Aprons

Sold by

Size: Standard

You won’t have to kiss the cook if you get them one of these classic aprons. It's super useful with its three spacious front pockets - perfect for all your utensils and tools. Select a design from our marketplace or customise it and unleash your creativity!

  • Dimensions: 60.96 cm L x 71.12 cm W
  • Material: 100% Polyester
  • Machine washable

About This Design

Glitch scion of purple cubimal standard apron

Glitch scion of purple cubimal standard apron

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.8 out of 5 stars rating2.4K Total Reviews
1979 total 5-star reviews306 total 4-star reviews40 total 3-star reviews15 total 2-star reviews15 total 1-star reviews
2,355 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Mridula C.4 October 2021Verified Purchase
Apron, Standard
Zazzle Reviewer Program
I absolutely love this apron!! The design on the apron and the colour of the apron came out exactly as what was shown in the picture. Beautiful product and a great idea for a birthday present. My friend loved it! The printing was stunning! it was beautifully designed and it came out really well. I was very happy with the result :)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lauren M.11 May 2021Verified Purchase
Apron, Standard
Zazzle Reviewer Program
I bought this as a little extra gift for my friend for her suprise bridal shower as we were doing a clay making class so it was to protect her outfit! But it’s so beautiful she is also going to keep it for her kitchen (she loves baking). It’s a really nice length as well, sitting at mid-thigh length. Beautiful colours! Pastel.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Rita29 May 2020Verified Purchase
Apron, Standard
Zazzle Reviewer Program
Cute, heavy duty apron with wide front pocket. Light to wear and easy slip on and off. Shorter length perfect for my 5 ft frame. I love it! Wording and print looks good with clear borders. Stitching is good, nicely finished.

Tags

Aprons
scionpurplecubimalglitchglitchenwetdryvactinyspeckglitchthegame
All Products
scionpurplecubimalglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 154390357675138028
Added on 23/11/13, 5:46 pm
Rating: G