Tap / click on image to see more RealViewsTM
$27.55
per mouse pad
 

Glitch: quest icon teleport mouse pad

Qty:

    Other designs from this category

    About Mousepads

    Sold by

    Style: Mouse Pad

    Create a great accessory for the only mouse you want scurrying around with a custom mouse pad for your home or office! Decorate it with your favourite image or choose from thousands of designs that look great and protect your mouse from scratches and debris. You can also design fun mouse pads to hand out to new employees or to use as marketing materials!

    • Dimensions: 23.49 cm l x 19.68 cm w
    • High quality, full-colour printing
    • Durable and dust and stain resistant cloth cover
    • Non-slip rubber backing
    • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 23.49 cm x 19.68 cm

    About This Design

    Glitch: quest icon teleport mouse pad

    Glitch: quest icon teleport mouse pad

    Glitch: quest icon teleport This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

    Customer Reviews

    4.8 out of 5 stars rating4.8K Total Reviews
    4261 total 5-star reviews387 total 4-star reviews77 total 3-star reviews28 total 2-star reviews31 total 1-star reviews
    4,784 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By R.20 December 2021Verified Purchase
    Mousepad
    Zazzle Reviewer Program
    Item was well packed and arrived quickly. The item was of great quality, beautiful colours and well made.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Marie M.28 January 2022Verified Purchase
    Mousepad
    Zazzle Reviewer Program
    First time ordering with Zazzle so did not know what to expect but it was delivered promptly and has a lovely feel. Wanted a new mouse mat & only ones available were $2 cheap & nasty. Use it with the Peacock Eyes at the top and it looks and feel great. Very happy with printing colours excellent.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Tony C.4 June 2021Verified Purchase
    Mousepad
    Zazzle Reviewer Program
    excellent texture and quality - mouse just glides. the photo is awesome

    Tags

    Mousepads
    questiconteleportglitchglitchenwetdryvactinyspeckglitchthegame
    All Products
    questiconteleportglitchglitchenwetdryvactinyspeckglitchthegame

    Other Info

    Product ID: 144536664552398505
    Added on 3/10/14, 9:20 am
    Rating: G