Tap / click on image to see more RealViewsTM
$8.95
per magnet
 

Glitch: patch seedling magnet

Qty:
Circle
+$3.35
+$1.55
Small, 3.2 Cm
+$1.55
+$3.00

Other designs from this category

About Magnets

Sold by

Shape: Circle

Give your fridge a personality upgrade. Upload a photo, design, or logo and turn it into a magnet that actually looks good up there.

  • Available in 3 sizes: 3.2 cm, 5.7 cm, and 7.6 cm diameter
  • USA-made with recycled domestic steel
  • Smooth glossy mylar finish, scratch and UV-resistant
  • Printed on FSC-certified recycled paper
  • Standard fridge-strength magnet
  • Also available in square or rectangle

About This Design

Glitch: patch seedling magnet

Glitch: patch seedling magnet

Glitch: patch seedling This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating7.1K Total Reviews
6264 total 5-star reviews584 total 4-star reviews121 total 3-star reviews47 total 2-star reviews44 total 1-star reviews
7,060 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Aggie C.19 December 2021Verified Purchase
Magnet, Style: Circle, Size: Standard, 5.7 Cm
Zazzle Reviewer Program
I was amazed how fabulous they turned out, will be ordering again and again. Customer beyond thrilled. All the magnets look amazing on my fridge. Fabulous and great quality!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Aggie C.19 December 2021Verified Purchase
Magnet, Style: Circle, Size: Small, 3.2 Cm
Zazzle Reviewer Program
I was amazed how fabulous they turned out, will be ordering again and again. Customer beyond thrilled. All the magnets look amazing on my fridge. Fabulous and great quality
5.0 out of 5 stars rating
5 out of 5 stars rating
By Daisy P.14 November 2021Verified Purchase
Magnet, Style: Circle, Size: Standard, 5.7 Cm
Zazzle Reviewer Program
Thankyou, it arrived safely today on 15th November 2021 at 8:30am. Turned out perfect thankyou

Tags

Magnets
patchseedlingglitchglitchenwetdryvactinyspeckglitchthegame
All Products
patchseedlingglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 147131969594404600
Added on 3/10/14, 7:17 am
Rating: G