Tap / click on image to see more RealViewsTM
$50.15
per apron
 

Glitch: orange juice standard apron

Qty:
Standard
White

Other designs from this category

About Aprons

Sold by

Size: Standard

You won’t have to kiss the cook if you get them one of these classic aprons. It's super useful with its three spacious front pockets - perfect for all your utensils and tools. Select a design from our marketplace or customise it and unleash your creativity!

  • Dimensions: 60.96 cm L x 71.12 cm W
  • Material: 100% Polyester
  • Machine washable

About This Design

Glitch: orange juice standard apron

Glitch: orange juice standard apron

Glitch: orange juice This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating2.4K Total Reviews
1979 total 5-star reviews306 total 4-star reviews39 total 3-star reviews15 total 2-star reviews14 total 1-star reviews
2,353 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lauren M.11 May 2021Verified Purchase
Apron, Standard
Zazzle Reviewer Program
I bought this as a little extra gift for my friend for her suprise bridal shower as we were doing a clay making class so it was to protect her outfit! But it’s so beautiful she is also going to keep it for her kitchen (she loves baking). It’s a really nice length as well, sitting at mid-thigh length. Beautiful colours! Pastel.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Mridula C.4 October 2021Verified Purchase
Apron, Standard
Zazzle Reviewer Program
I absolutely love this apron!! The design on the apron and the colour of the apron came out exactly as what was shown in the picture. Beautiful product and a great idea for a birthday present. My friend loved it! The printing was stunning! it was beautifully designed and it came out really well. I was very happy with the result :)
5.0 out of 5 stars rating
5 out of 5 stars rating
By R.29 May 2020Verified Purchase
Apron, Standard
Zazzle Reviewer Program
Cute, heavy duty apron with wide front pocket. Light to wear and easy slip on and off. Shorter length perfect for my 5 ft frame. I love it! Wording and print looks good with clear borders. Stitching is good, nicely finished.

Tags

Aprons
orangejuiceglitchglitchenwetdryvactinyspeckglitchthegame
All Products
orangejuiceglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 154922724085174673
Added on 3/10/14, 8:16 am
Rating: G