Tap / click on image to see more RealViewsTM
$88.95
per clock
 

Glitch: limited edition imitation grichmas yeti round clock

Qty:
20.3 cm Round Acrylic
+$12.05
+$12.05
-$11.25
-$11.25
-$11.25

Other designs from this category

About Wall Clocks

Sold by

Style: 20.3 cm Round Acrylic Wall Clock

Customise your wall clock to create a functional wall décor statement piece to perfectly match your home décor, show off your art or favourite photo, or give as a personalised gift. This unique, high-quality wall clock is vibrantly printed with AcryliPrint®HD process and features a pre-installed backside hanging slot for easy hanging and a non-ticking design.

  • 2 sizes: 20.32 cm diameter or 27.30 cm diameter
  • Material: Grade-A acrylic
  • One AA battery required (not included)
  • Add photos, artwork, and text
  • Indoor use only, not recommended for outdoor use

About This Design

Glitch: limited edition imitation grichmas yeti round clock

Glitch: limited edition imitation grichmas yeti round clock

Glitch: limited edition imitation grichmas yeti This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.7 out of 5 stars rating3.6K Total Reviews
3003 total 5-star reviews399 total 4-star reviews82 total 3-star reviews44 total 2-star reviews70 total 1-star reviews
3,598 Reviews
Reviews for similar products
5 out of 5 stars rating
By Candice M.30 October 2020Verified Purchase
Wall Clock, 27.3 cm Round Acrylic
Zazzle Reviewer Program
Absolutely love this clock for my daughter's nursery. Perfect size and light weight. Have ordered another for my nephew. Fantastic. Looks great in her room.
5 out of 5 stars rating
By Shelley T.31 March 2022Verified Purchase
Wall Clock, 20.3 cm Round Acrylic
Zazzle Reviewer Program
I was decorating a bedroom for a young soccer fan and this was an ideal accessory. The young man loves it. Excellent printing and easy to read for a 9 year old.
5 out of 5 stars rating
By N.2 August 2016Verified Purchase
Wall Clock, 27.3 cm Round Acrylic
Zazzle Reviewer Program
Other reviews complained about the quality - but even through it was made of plastic - it did not feel flimsy, and the graphics were perfectly rendered and vibrant - exactly what I had designed. Cant go wrong at this price It was made and shipped to me within a day or so - I got in in Australia (From California) - within a week - unreal. Very Happy. Perfect - colours vibrant - faithfully replicated my design

Tags

Wall Clocks
limitededitionimitationgrichmasyetiglitchglitchenwetdryvactinyspeckglitchthegame
All Products
limitededitionimitationgrichmasyetiglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 256753996524584946
Added on 3/10/14, 7:10 am
Rating: G