Tap / click on image to see more RealViewsTM
$55.30
per shirt
 

Glitch emo bear cubimal T-Shirt

Qty:
Womens Basic T-Shirt
+$24.10
+$51.95
Black
Classic Printing: No Underbase
-$10.95
-$10.95
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft – a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customise it and unleash your creativity!

Size & Fit

  • Model is 5'7"/170 cm and is wearing a Small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Tagless label for comfort
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Glitch emo bear cubimal T-Shirt

Glitch emo bear cubimal T-Shirt

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.5 out of 5 stars rating15.1K Total Reviews
10685 total 5-star reviews2901 total 4-star reviews844 total 3-star reviews388 total 2-star reviews264 total 1-star reviews
15,082 Reviews
Reviews for similar products
5 out of 5 stars rating
By Ritz M.14 December 2020Verified Purchase
Womens Basic T-Shirt, White, Adult M
Zazzle Reviewer Program
Love how the print turn out for an affordable price. My tshirt looks really good
5 out of 5 stars rating
By Lili T.24 October 2025Verified Purchase
Womens Basic T-Shirt, White, Adult S
Good quality and clear photo.
5 out of 5 stars rating
By J.27 December 2020Verified Purchase
Womens Basic T-Shirt, White, Adult L
Zazzle Reviewer Program
The Shirt says it all - it is exactly as I wanted it and I couldn't be happier. This is a 10 out of 10 shirt. Ticks all the boxes. Thank you again Zazzle. No issues with the printing. It was perfect

Tags

T-Shirts
glitchglitchenemobearcubimalwetdryvactinyspeckglitchthegame
All Products
glitchglitchenemobearcubimalwetdryvactinyspeckglitchthegame

Other Info

Product ID: 235217361453915941
Added on 23/11/13, 5:39 pm
Rating: G