Tap / click on image to see more RealViewsTM
$55.30
per shirt
 

Glitch Emblem Alph T-Shirt

Qty:
Basic Dark T-Shirt
-$2.60
+$18.40
Black
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Basic Dark T-Shirt

Comfortable, casual and loose fitting, our heavyweight dark colour t-shirt will quickly become one of your favourites. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability. Select a design from our marketplace or customise it to make it uniquely yours!

Size & Fit

  • Model is 188 cm and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Imported
  • Machine wash cold

About This Design

Glitch Emblem Alph T-Shirt

Glitch Emblem Alph T-Shirt

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.7 out of 5 stars rating32.8K Total Reviews
25674 total 5-star reviews4984 total 4-star reviews1118 total 3-star reviews511 total 2-star reviews493 total 1-star reviews
32,780 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Robert C.1 March 2022Verified Purchase
Basic Dark T-Shirt, Black, Large
Creator Review
I purchased this to test to see if zazzle was producing good quality. Needless to say, they are. The sizing runs a bit on the small size though. Print quality is perfect. What you see on the screen is what you get.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Xavier D.3 February 2021Verified Purchase
Basic Dark T-Shirt, Black, Medium
Creator Review
I like the colours and design, I liked it that much I bought one for myself. Yes the colours and deisgn turned out great. Much better than I expected
5.0 out of 5 stars rating
5 out of 5 stars rating
By Rachel R.4 September 2025Verified Purchase
Basic Dark T-Shirt, Black, Small
Ordered the Irish terrier t shirt. I love it! There was a slight issue with sizing ( my fault) but their customer service was amazing. New t shirt within 5 days. I recommend getting 1 to 2 sizes bigger. I am wearing Men's size large.

Tags

T-Shirts
glitchglitchengiantgiantsemblemalphwetdryvactinyspeckglitchthegame
All Products
glitchglitchengiantgiantsemblemalphwetdryvactinyspeckglitchthegame

Other Info

Product ID: 235281568725117906
Added on 23/11/13, 5:34 pm
Rating: G