Tap / click on image to see more RealViewsTM
$27.55
per notebook
 

Glitch: compounds diabolic acid notebook

Qty:

Other designs from this category

About Notebooks

Sold by

Style: 16.51 cm x 22.22 cm Classic Notebook

Organise your day with a custom notebook! Made with your images and text on the front cover, this notebook is a great way to show off your personal style and keep track of all important notes and appointments all at once.

  • Dimensions: 16.5 cm x 22.2 cm (6.5" x 8.75")
  • Cover printed in vibrant, sharp colour
  • 80 black & white lined pages
  • College ruled
  • Lay flat spiral binding
This product is recommended for ages 8+..
Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 16.5 cm x 22.2 cm (6.5" x 8.75"). For best results please add 0.3 cm (1/8") bleed..

About This Design

Glitch: compounds diabolic acid notebook

Glitch: compounds diabolic acid notebook

Glitch: compounds diabolic acid This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating1.8K Total Reviews
1531 total 5-star reviews188 total 4-star reviews42 total 3-star reviews28 total 2-star reviews16 total 1-star reviews
1,805 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By I.15 July 2015Verified Purchase
16.51 cm x 22.22 cm Classic Notebook
Zazzle Reviewer Program
This arrived So Much faster than I was expecting. I left plenty of time for international shipping and then didn't need it. I wasn't sure how the image would turn out (have never bought a notebook from Zazzle before). I was pleasantly surprised by the quality of the image.
5.0 out of 5 stars rating
5 out of 5 stars rating
By M.30 December 2017Verified Purchase
16.51 cm x 22.22 cm Classic Notebook
Creator Review
Item was exactly as described. Very pleased. Print was excellent quality.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Robert K.18 May 2022Verified Purchase
16.51 cm x 22.22 cm Classic Notebook
Creator Review
The image was bright and crisp - the details of the artwork came out perfectly. The paper is easy to write on. Perfect printing - better than expected!

Tags

Notebooks
compoundsdiabolicacidglitchglitchenwetdryvactinyspeckglitchthegame
All Products
compoundsdiabolicacidglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 130823130589919417
Added on 3/10/14, 8:42 am
Rating: G