Tap / click on image to see more RealViewsTM
$57.70
per tie
 

Glitch: artefact platinumium spork tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe with a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139 cm
    • Width: 10.1 cm (at widest point)
  • Printed in vibrant full colour
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customise
  • Dry clean only

About This Design

Glitch: artefact platinumium spork tie

Glitch: artefact platinumium spork tie

Glitch: artefact platinumium spork This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.5 out of 5 stars rating2.4K Total Reviews
1792 total 5-star reviews327 total 4-star reviews127 total 3-star reviews63 total 2-star reviews93 total 1-star reviews
2,402 Reviews
Reviews for similar products
5 out of 5 stars rating
By Amy C.17 May 2022Verified Purchase
Tie
Zazzle Reviewer Program
It's absolutely perfect!! Turned out much better then I expected ❤️ It is a little expensive but very worth it. Printing is perfect can read it very well
5 out of 5 stars rating
By Natalie-Ann G.15 July 2019Verified Purchase
Tie
Zazzle Reviewer Program
Thanks for delivering this wonderful tie for my best friends 40th 90s theme birthday party. My partner and I are dressing up as Mulder and Scully and the tie is very Mulderish. The character should have worn one in the show. Tie arrived quickly and everything went smoothly with the purchase. Would highly recommend Zazzle to other shoppers. 👽😃. Exactly like picture
4 out of 5 stars rating
By Anonymous14 September 2025Verified Purchase
Tie
I originally ordered 1 tie to test and ensure I liked it with the suits we had ordered! The tie came and it was perfect! We loved it! The colours were bright and the tie was beautifully made. I then ordered the 6 additional ties and the colours are slightly different. The 6 ties were a little less vibrant and the white background was slightly different! .

Tags

Ties
artefactplatinumiumsporkglitchglitchenwetdryvactinyspeckglitchthegame
All Products
artefactplatinumiumsporkglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 151821879205526844
Added on 3/10/14, 7:30 am
Rating: G