Tap / click on image to see more RealViewsTM
$8.55
per card
 

Glitch: achievement loyal alloyer

Qty:
Choose Your Format
Signature Matte
  • 17 pt thickness / 120 lb weight
  • Light white, uncoated matte finish with an eggshell texture
+$1.20
+$1.20
-$0.35

About Cards

Sold by

Size: Standard (12.7 cm x 17.8 cm)

Birthdays or holidays, good days or hard days, Zazzle’s Customised greeting cards are the perfect way to convey your wishes on any occasion. Add a photo or pick a design and brighten someone’s day with a simple “hi”!

  • Dimensions: 12.7 cm x 17.8 cm (portrait) or 17.8 cm x 12.7 cm (landscape)
  • Full colour CMYK print process
  • All-sided printing for no additional cost
  • Printable area on the back of the card is 7.62 cm x 10.16 cm (portrait) or 10.16 cm x 7.62 cm (landscape)
  • Blank white envelopes included

Paper Type: Matte

The most popular paper choice, Matte’s eggshell texture is soft to the touch with a smooth finish that provides the perfect backdrop for your chosen designs.

  • Light white, uncoated matte finish with an eggshell texture
  • Paper is easy to write on and won't smudge

About This Design

Glitch: achievement loyal alloyer

Glitch: achievement loyal alloyer

Glitch: achievement loyal alloyer This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.9 out of 5 stars rating7.4K Total Reviews
6781 total 5-star reviews495 total 4-star reviews71 total 3-star reviews28 total 2-star reviews42 total 1-star reviews
7,417 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By E.15 November 2021Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Zazzle Reviewer Program
Lovely quality cards. Nice to get a real traditional Chrismassy theme in Australia, not the beach and Australian animals stuff. Excellent, would use again
5.0 out of 5 stars rating
5 out of 5 stars rating
By Angela M.16 November 2022Verified Purchase
Folded Card, Size: Big (21.6 cm x 28 cm), Paper: Signature Matte
Zazzle Reviewer Program
Easy to order Good price Quick delivery. Card came out exactly as ordered
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lyn B.19 December 2021Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Zazzle Reviewer Program
This was exactly what was wanted for my piano crazy grandson! He is self taught & is now having lessons by a top teacher and has been asked to play at various venues in the US! We are so proud of him and this card was so just right for him! I couldn’t tell because I had it sent directly to him because I am in Australia & he is in the US but he said it was beautiful!!

Tags

Cards
achievementloyalalloyerglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementloyalalloyerglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 137429455615487266
Added on 23/10/14, 8:43 am
Rating: G