Tap / click on image to see more RealViewsTM
$19.80
per keychain
 

Glitch: achievement hero cubimals key ring

Qty:
Aluminum Circle
+$5.15
+$5.15
+$25.30
+$25.30

Other designs from this category

About Keychains

About This Design

Glitch: achievement hero cubimals key ring

Glitch: achievement hero cubimals key ring

Glitch: achievement hero cubimals This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.6 out of 5 stars rating5.6K Total Reviews
4339 total 5-star reviews801 total 4-star reviews222 total 3-star reviews119 total 2-star reviews106 total 1-star reviews
5,587 Reviews
Reviews for similar products
5 out of 5 stars rating
By T.29 May 2025Verified Purchase
Metal Circle Keychain, 5.08 cm
A huge big THANK YOU to the designer Little Linda Pinda. This was a special order and it turned out so lovely. Very happy. And the delivery was super quick too.
5 out of 5 stars rating
By Ali Y.4 February 2026Verified Purchase
Metal Circle Keychain, 5.08 cm
Lovely & cute keychains i love them thank you sooo much ,they also reached to me soo fast 😍.
from zazzle.com (US)
5 out of 5 stars rating
By T.29 May 2025Verified Purchase
Metal Circle Keychain, 5.08 cm
A huge big THANK YOU to the designer Little Linda Pinda. This was a special order and it turned out so lovely. Very happy. And the delivery was super quick too.

Tags

Keychains
achievementherocubimalsglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementherocubimalsglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 146528940696249206
Added on 22/10/14, 12:39 pm
Rating: G