Tap / click on image to see more RealViewsTM
$40.10
per specialty mug
 

Glitch: achievement harmony hound bone china mug

Qty:
Bone China
+$10.05
-$2.50

Other designs from this category

About Mugs

Sold by

Style: Bone China

Ready for your coffee, tea, soup, cider, or other tasty beverage, this fine porcelain mug complements both casual and formal table settings. It features a subtly fluted rim and an elegantly curved handle. Serves as a great housewarming gift!

  • Dimensions:
    • 295 ml: 7.1 cm D x 10.2 cm H
    • Microwave and dishwasher safe
    • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
    • Strong, ceramic construction
    • Meets FDA requirements for food and beverage safety
    • Do not overfill and be careful with hot liquids that may scald
    • Keep out of reach of children when filled with hot liquid
    Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 8.3 cm high x 18.4 cm wide
  • About This Design

    Glitch: achievement harmony hound bone china mug

    Glitch: achievement harmony hound bone china mug

    Glitch: achievement harmony hound This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

    Customer Reviews

    4.8 out of 5 stars rating1.2K Total Reviews
    1083 total 5-star reviews78 total 4-star reviews15 total 3-star reviews5 total 2-star reviews18 total 1-star reviews
    1,199 Reviews
    Reviews for similar products
    5 out of 5 stars rating
    By Jennifer M.13 March 2021Verified Purchase
    Bone China Mug
    Zazzle Reviewer Program
    Nice to have a cup of tea in a lovely mug with my name on it. I had one before and broke it by mistake. So pleased I could get another one!!!! The design was perfect - same as the icon that I sent to them, as below. Terrific service.
    5 out of 5 stars rating
    By Sarah C.12 January 2018Verified Purchase
    Jumbo Mug
    Zazzle Reviewer Program
    I love the gorgeous lettering on this and it's the perfect gift for the women in your life! The printing looked good, I like how the image was on both sides of the mug.
    from zazzle.com (US)
    5 out of 5 stars rating
    By Peter K.5 April 2020Verified Purchase
    Bone China Mug
    Creator Review
    Very nice colour scheme. Printing is crisp and sharp.

    Tags

    Mugs
    achievementharmonyhoundglitchglitchenwetdryvactinyspeckglitchthegame
    All Products
    achievementharmonyhoundglitchglitchenwetdryvactinyspeckglitchthegame

    Other Info

    Product ID: 183489589679976770
    Added on 22/10/14, 12:23 pm
    Rating: G