Tap / click on image to see more RealViewsTM
$19.80
per keychain
 

Glitch: achievement grease monkey key ring

Qty:
  1. Style

Other designs from this category

About Keychains

About This Design

Glitch: achievement grease monkey key ring

Glitch: achievement grease monkey key ring

Glitch: achievement grease monkey This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.6 out of 5 stars rating5.6K Total Reviews
4362 total 5-star reviews802 total 4-star reviews225 total 3-star reviews122 total 2-star reviews108 total 1-star reviews
5,619 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tracey29 May 2025 • Verified Purchase
Metal Circle Keychain, 5.08 cm
A huge big THANK YOU to the designer Little Linda Pinda. This was a special order and it turned out so lovely. Very happy. And the delivery was super quick too.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tracey29 May 2025 • Verified Purchase
Metal Circle Keychain, 5.08 cm
A huge big THANK YOU to the designer Little Linda Pinda. This was a special order and it turned out so lovely. Very happy. And the delivery was super quick too.
5.0 out of 5 stars rating
5 out of 5 stars rating
By cindy t.8 November 2023 • Verified Purchase
Metal Circle Keychain, 5.08 cm
Zazzle Reviewer Program
Product quality is great, art work is perfect. Would highly recommend. Fast turn around, I was surprised they arrived so quickly, as I had a fairly large order. Perfect, centred and exactly what I wanted

Tags

achievementgreasemonkeyglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 146436455836283056
Added on 21/10/14, 6:28 pm
Rating: G