Tap / click on image to see more RealViewsTM
$25.00
per coaster
 

Glitch: achievement grease monkey coaster

Qty:

    Other designs from this category

    About Coasters

    Sold by

    Style: Sandstone Drink Coaster

    Mom always told you to use a coaster, so make her happy by using one from Zazzle! Made to keep your tables scratch-and-moisture-free, our sandstone coasters have a cork backing, so you can use them on any surface. They also have a matte finish and work best with vintage illustrations, black-and-white photos, and personal text messages.

    • Dimensions:
      • Diameter: 10.8 cm
      • Thickness: 0.6 cm
      • Weight: 110 g.
    • Made of sandstone with a cork pad backing
    • Not dishwasher safe
    Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 10.8 cm x 10.8 cm. For best results please add 0.3 cm (1/8") bleed.

    About This Design

    Glitch: achievement grease monkey coaster

    Glitch: achievement grease monkey coaster

    Glitch: achievement grease monkey This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

    Customer Reviews

    4.6 out of 5 stars rating503 Total Reviews
    392 total 5-star reviews69 total 4-star reviews20 total 3-star reviews7 total 2-star reviews15 total 1-star reviews
    503 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Bob3 November 2012Verified Purchase
    Sandstone Coaster
    Zazzle Reviewer Program
    surprisingly good quality......not just a casual gift. sharp and appropriate
    from zazzle.com (US)
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Kari13 May 2024Verified Purchase
    Beautiful horse drawing on this coaster makes it a great conversation piece. Artist is very talented! The printing Zazzle did is nice and crisp, but not as black as I would have liked and the edges had some execess on them But some sandpaper fixed the issue
    from zazzle.com (US)
    Original product
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Gravityx9 D.21 May 2026Verified Purchase
    Sandstone Coaster
    Creator Review
    Bright and colorful! The printing is nice and crisp. True to color as seen on the webpage. The cork backing is well placed and there are no loose edges. I love this sandstone coaster! I would recommend this product for gifts, stocking stuffers, or for yourself!
    from zazzle.com (US)

    Tags

    achievementgreasemonkeyglitchglitchenwetdryvactinyspeckglitchthegame

    Other Info

    Product ID: 174689606721833814
    Added on 21/10/14, 6:28 pm
    Rating: G