Tap / click on image to see more RealViewsTM
$55.30
per shirt
 

Glitch: achievement forgey laforge T-Shirt

Qty:
Basic T-Shirt
+$17.35
+$24.10
Black
Classic Printing: No Underbase
-$10.95
-$10.95
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft – a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customise it and unleash your creativity!

Size & Fit

  • Model is 5'7"/170 cm and is wearing a Small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Tagless label for comfort
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Glitch: achievement forgey laforge T-Shirt

Glitch: achievement forgey laforge T-Shirt

Glitch: achievement forgey laforge This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.5 out of 5 stars rating15.2K Total Reviews
10754 total 5-star reviews2904 total 4-star reviews848 total 3-star reviews398 total 2-star reviews273 total 1-star reviews
15,177 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ritz M.14 December 2020Verified Purchase
Basic T-Shirt, White, Medium
Zazzle Reviewer Program
Love how the print turn out for an affordable price. My tshirt looks really good
5.0 out of 5 stars rating
5 out of 5 stars rating
By cathie C.5 October 2020Verified Purchase
Basic T-Shirt, White, Small
Zazzle Reviewer Program
First time ordering from this website. A bit hesitant at first but it was cheaper from what i had seen. I wanted a T-shirt to display the hard work we in the medical field have been encountering through this COVID. I wanted it to represent the harder work that we do every day. Just as pictured and what i had made was its coloring as in picture. The size ran big according to measurements for my basic relax fit T-shirt. When i was contacted my team member in zazzle and explained ,they replaced for my usual size of L and it came even quicker at no extra charge. If you choose the basic t-shirt like i did, go with what you usually would don't go by sizing chart. I would highly recommend Great work.. The colour was as expected and the blue was great, even better.
5.0 out of 5 stars rating
5 out of 5 stars rating
By J.27 December 2020Verified Purchase
Basic T-Shirt, White, Large
Zazzle Reviewer Program
The Shirt says it all - it is exactly as I wanted it and I couldn't be happier. This is a 10 out of 10 shirt. Ticks all the boxes. Thank you again Zazzle. No issues with the printing. It was perfect

Tags

T-Shirts
achievementforgeylaforgeglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementforgeylaforgeglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 235881824069749665
Added on 13/10/14, 1:05 pm
Rating: G