Tap / click on image to see more RealViewsTM
$67.75
per set of six
 

Glitch: achievement first alph emblem coaster

Qty:

Other designs from this category

About Cork Coasters

Sold by

Style: Hard Plastic coasters with cork back - set of 6

Decorate your home with custom coasters! Made with high-gloss plastic and a non-skid cork backing, these coasters display your photos and designs with vivid and sharp colors. Perfect for hot and cold drinks, custom coasters are a great complement to any table or surface.

  • Dimensions: 9.6 cm x 9.6 cm (3.8" x 3.8")
  • Coasters come in sets of 6
  • High gloss plastic with non-skid cork backing
  • Easy wipe-clean surface
Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 8.1 cm x 8.1 cm (3.2" x 3.2"). For best results please add 0.3 cm (1/8") bleed..

About This Design

Glitch: achievement first alph emblem coaster

Glitch: achievement first alph emblem coaster

Glitch: achievement first alph emblem This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating417 Total Reviews
376 total 5-star reviews27 total 4-star reviews6 total 3-star reviews5 total 2-star reviews3 total 1-star reviews
417 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Linda C.14 February 2021Verified Purchase
Hard Plastic coasters with cork back - set of 6
Creator Review
A great quality product. Have ordered many of these coasters, including other designs for gifts for family & friends. Even have my own se. Extremely good print.
5.0 out of 5 stars rating
5 out of 5 stars rating
By E.29 November 2021Verified Purchase
Hard Plastic coasters with cork back - set of 6
Zazzle Reviewer Program
I bought these coasters to go with my mouse pad, also from Zazzle. They arrived in really fast time and were well packaged. The quality of the coaster is better than I imagined, they look very durable and unlikely to blemish like normal coasters. Very pleased with this purchase. The printing is perfect on each coaster, they look very smart indeed. I love them.
1.0 out of 5 stars rating
1 out of 5 stars rating
By Janiene P.23 December 2025Verified Purchase
Hard Plastic coasters with cork back - set of 6
Order arrived and one of the coasters is damaged. Can you please arrange replacement. Pretty disappointed as this is a Christmas gift. .

Tags

Cork Coasters
achievementfirstalphemblemglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementfirstalphemblemglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 163389945369715017
Added on 13/10/14, 12:41 pm
Rating: G