Tap / click on image to see more RealViewsTM
$435.00
per watch
 

Glitch: achievement bubble tea aficionado watch

Qty:
Heads-up!
Sorry, this product is completely sold out.
  1. Size

  2. Style

About Watches

Sold by

Style: Men's Stainless Steel Bracelet Watch

The Men's Stainless Steel Watch is built for adventure. Designed as a nod to classic diver and military watches, it features stainless steel construction, an adjustable bezel, and water resistance to over 91.4 metres. Personalise the watch with your designs and text for a stylish memento that’s as rugged as you!

  • Men's wrist watch
  • Material:
    • Case: Stainless Steel
    • Strap: Stainless Steel
  • Dimensions:
    • Face: 3.1 cm diameter
    • Strap: 22.1 cm x 2.2 cm
    • Case: 4.2 cm diameter
    • Weight: 141.5 g
  • 3-hand analog Japan Quartz®
  • Full colour custom printing on face
  • Also available with a leather strap
  • Foldover clasp with trifold closure
  • Water Resistance: Up to 10 ATM (100 metres)
  • 1 year manufacturers limited warranty
  • Battery included
  • This product is recommended for ages 13+

About This Design

Glitch: achievement bubble tea aficionado watch

Glitch: achievement bubble tea aficionado watch

Glitch: achievement bubble tea aficionado This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.6 out of 5 stars rating1.3K Total Reviews
1049 total 5-star reviews155 total 4-star reviews32 total 3-star reviews22 total 2-star reviews78 total 1-star reviews
1,336 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous6 March 2026 • Verified Purchase
The watch is very strong and sturdy for every day wear. Nice looking watch. .
from zazzle.com (US)
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By Miriam S.19 March 2026 • Verified Purchase
Watch, Stainless Steel Bracelet
Excellent watches love it .
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Beryl C.23 April 2023 • Verified Purchase
Zazzle Reviewer Program
This watch is absolutely amazing for our son's graduation! A quality product. Delivered ahead of schedule! The print was perfect.
from zazzle.com (US)

Tags

achievementbubbleteaaficionadoglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 256004886589627231
Added on 7/10/14, 9:21 am
Rating: G