Tap / click on image to see more RealViewsTM
$40.10
per towel
 

Glitch: achievement bubble tea aficionado tea towel

Qty:

Other designs from this category

About Kitchen Towels

Sold by

Style: Tea Towel 40.6 cm x 61 cm

Brighten up any kitchen with a set of new kitchen towels! Made of durable poly-blend, these towels are great for drying and will look vibrant with your text, monogram or artwork. Designed for a lifetime of use, these machine washable kitchen towels look great and clean up well, too!

  • Dimensions: 40.6 cm x 60.9 cm
  • Durable woven polyester / polyamide blend microfibre; 80% Polyester / 20% Polyamide
  • Machine washable
  • Made and shipped from the USA
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 60.9 cm (16" x 24"). For best results please add 1.8 cm (5/7") bleed..

About This Design

Glitch: achievement bubble tea aficionado tea towel

Glitch: achievement bubble tea aficionado tea towel

Glitch: achievement bubble tea aficionado This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.7 out of 5 stars rating1.2K Total Reviews
1041 total 5-star reviews127 total 4-star reviews37 total 3-star reviews13 total 2-star reviews19 total 1-star reviews
1,237 Reviews
Reviews for similar products
4 out of 5 stars rating
By Sharon C.21 February 2024Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
Feedback from those I gave them to was very positive, and they mentioned the material as being good. Happy with the print
5 out of 5 stars rating
By Anonymous26 December 2025Verified Purchase
Kitchen Towel
Great product, fast service, very happy, highly recommend!
5 out of 5 stars rating
By Julie b.7 June 2025Verified Purchase
Kitchen Towel
The recipient loved it great gift idea.

Tags

Kitchen Towels
achievementbubbleteaaficionadoglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementbubbleteaaficionadoglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 197627184993330891
Added on 7/10/14, 9:21 am
Rating: G