Tap / click on image to see more RealViewsTM
$20.55
per sheet of 6
 

Glitch: achievement better bubble farmer classic round sticker

Qty:
Classic Round Stickers
+$0.80
+$0.80
+$0.80

Other designs from this category

About Stickers

Sold by

Shape: Classic Round Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Glitch: achievement better bubble farmer classic round sticker

Glitch: achievement better bubble farmer classic round sticker

Glitch: achievement better bubble farmer This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating27.7K Total Reviews
23950 total 5-star reviews2267 total 4-star reviews582 total 3-star reviews366 total 2-star reviews570 total 1-star reviews
27,735 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Aldo A.24 December 2023Verified Purchase
Zazzle Reviewer Program
Great customer service. After a long delay, I contacted Zazzle and they immediately declared the stickers were lost by the post. Another printout was created and expressed post at no cost to me. They came within a week in time for our first harvest. The stickers are exactly as ordered. They fit perfectly on my small honey jars. My daughter, Philippa is over the moon to see her name on the honey jars.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Frances B.8 November 2023Verified Purchase
Zazzle Reviewer Program
First purchase from Zazzle and it didn't disappoint. Quality sticker labels that go on beautifully without bubbles and creases. Arrived on time. Have just purchased again. quality printing and label
5.0 out of 5 stars rating
5 out of 5 stars rating
By C.18 July 2021Verified Purchase
Zazzle Reviewer Program
These stickers were perfect!! They turned out exactly how i planned. The quality is amazing, the wording and images were right - no fuzziness. Very very happy! Quality is amazing! Turned out better than expected

Tags

Stickers
achievementbetterbubblefarmerglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementbetterbubblefarmerglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 217097539878478632
Added on 6/10/14, 4:16 pm
Rating: G